KEGG   Cyanothece sp. PCC 8801: PCC8801_3754Help
Entry
PCC8801_3754      CDS       T00806                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:cyp00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PCC8801_3754
Enzymes [BR:cyp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PCC8801_3754
Two-component system [BR:cyp02022]
 CheA family
  WspE-WspRF [MD:M00509]
   PCC8801_3754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3942085..3943134
Genome map
AA seq 349 aa AA seqDB search
MRIAIVNDMMMAVAALQRVVTSVPDYEIAWIAHNGSQAIAHCATDTPDLILMDIIMPEID
GVEATHIIMEHSPCAILIVTASIKSNSSKIFEAMGYGALDVVSTPVLGRLGDPEAAAILL
DKIATIGVLIGQRKSKSVHKDLLKSANSRGKSKLSTPPSALPPLVVIGVSTGGPKALAVL
LGALPSSFPAAIVIIQHVDAQFAPGLATWLNKQTSLPVRLAMEGDSLKSGTVLLAGTNDH
LVLRPNLTLKYTEKPQDYPYRPSVDVFCQSVADYWSRKGTAVLLTGMGRDGALGLKELRS
KGWHTIAQDKQSCVVYGMPKAAVEMDSAVEILPLSDIAPALIKRVTPTS
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaggattgcaattgtcaatgatatgatgatggcagtggcagcattacagcgcgtggtc
acttccgttcctgattatgaaatcgcctggattgcccacaatggtagtcaagcgatcgcc
cattgtgccacggatacccctgatctcattctgatggatattatcatgccagagatcgat
ggggtagaagcgactcacatcatcatggaacattctccctgtgccattctgattgtcaca
gccagcatcaaaagcaattcctcgaaaatttttgaagccatgggctacggggctttagat
gtcgttagcacacccgtattaggacggttgggtgatcctgaagcagcagccattttactc
gataaaattgccaccattggggtcttaattggacaacgcaaatctaagtcagttcataaa
gatcttctaaaatccgccaatagtcggggaaaaagcaaactttcaacccctccttcagcc
ctacctcccttagtggtgattggagtctcaacaggcggtcctaaagccctagcagttctc
ttgggagctctgccaagcagttttccagcagcgatcgtcattattcagcacgtcgatgcg
caatttgctcccggtttagccacttggctcaacaaacaaacctccttacccgttcgtctg
gcgatggaaggggattcactgaaaagcggaaccgttttactagccggtacgaatgatcac
ttagtcttgcgtcccaatttaacgctaaaatatacagagaagcctcaagattacccctat
cgtccatcggtagatgttttttgccaaagtgtggctgactattggagtcgaaaaggaact
gccgtactacttacgggcatgggaagagatggggctttagggttgaaggagttacggtct
aaaggatggcacaccatcgcccaagataagcaaagctgtgtggtttatggaatgcccaaa
gctgctgttgagatggattctgccgttgaaattttacctttatctgacattgccccggct
ctgattaaaagagtcaccccaacatcttaa

DBGET integrated database retrieval system