KEGG   Cyanothece sp. PCC 8801: PCC8801_3754Help
Entry
PCC8801_3754      CDS       T00806                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
Two-component system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:cyp02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3942085..3943134
Genome map
AA seq 349 aa AA seqDB search
MRIAIVNDMMMAVAALQRVVTSVPDYEIAWIAHNGSQAIAHCATDTPDLILMDIIMPEID
GVEATHIIMEHSPCAILIVTASIKSNSSKIFEAMGYGALDVVSTPVLGRLGDPEAAAILL
DKIATIGVLIGQRKSKSVHKDLLKSANSRGKSKLSTPPSALPPLVVIGVSTGGPKALAVL
LGALPSSFPAAIVIIQHVDAQFAPGLATWLNKQTSLPVRLAMEGDSLKSGTVLLAGTNDH
LVLRPNLTLKYTEKPQDYPYRPSVDVFCQSVADYWSRKGTAVLLTGMGRDGALGLKELRS
KGWHTIAQDKQSCVVYGMPKAAVEMDSAVEILPLSDIAPALIKRVTPTS
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaggattgcaattgtcaatgatatgatgatggcagtggcagcattacagcgcgtggtc
acttccgttcctgattatgaaatcgcctggattgcccacaatggtagtcaagcgatcgcc
cattgtgccacggatacccctgatctcattctgatggatattatcatgccagagatcgat
ggggtagaagcgactcacatcatcatggaacattctccctgtgccattctgattgtcaca
gccagcatcaaaagcaattcctcgaaaatttttgaagccatgggctacggggctttagat
gtcgttagcacacccgtattaggacggttgggtgatcctgaagcagcagccattttactc
gataaaattgccaccattggggtcttaattggacaacgcaaatctaagtcagttcataaa
gatcttctaaaatccgccaatagtcggggaaaaagcaaactttcaacccctccttcagcc
ctacctcccttagtggtgattggagtctcaacaggcggtcctaaagccctagcagttctc
ttgggagctctgccaagcagttttccagcagcgatcgtcattattcagcacgtcgatgcg
caatttgctcccggtttagccacttggctcaacaaacaaacctccttacccgttcgtctg
gcgatggaaggggattcactgaaaagcggaaccgttttactagccggtacgaatgatcac
ttagtcttgcgtcccaatttaacgctaaaatatacagagaagcctcaagattacccctat
cgtccatcggtagatgttttttgccaaagtgtggctgactattggagtcgaaaaggaact
gccgtactacttacgggcatgggaagagatggggctttagggttgaaggagttacggtct
aaaggatggcacaccatcgcccaagataagcaaagctgtgtggtttatggaatgcccaaa
gctgctgttgagatggattctgccgttgaaattttacctttatctgacattgccccggct
ctgattaaaagagtcaccccaacatcttaa

DBGET integrated database retrieval system