KEGG   Cyanothece sp. PCC 8801: PCC8801_3925Help
Entry
PCC8801_3925      CDS       T00806                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cyp00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PCC8801_3925
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PCC8801_3925
Enzymes [BR:cyp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PCC8801_3925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4111693..4112190
Genome map
AA seq 165 aa AA seqDB search
MTTAQAPASIYDLSATSINGTPVSLSDYKDKVLLIVNTASQCGFTPQYKGLQALYDQYAS
QGLVVLGFPCNQFGQQEPGTADQIQSFCEVNFGVSFPLFQKIDVNGSNAHPLYQYLTKAV
PGILGIEAIKWNFTKFLVDRSGKVVKRYPPTTKPEDIAKDIQALL
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagcacaagcacctgcctccatttacgacctttctgccaccagtattaatggc
actcccgtgtccttaagcgactacaaagataaagtcttactaatcgtcaataccgccagt
caatgtggctttacacctcaatataagggattacaggctttatatgaccaatatgccagc
caagggttagtggttttaggctttccctgtaaccaattcggacaacaggaacctggaacc
gccgatcaaattcagtcgttttgtgaagtaaactttggggtttcctttcccctgtttcag
aaaatcgatgtcaatggcagcaatgcccatccattgtatcaatatttaacgaaagctgtt
cctggtattttgggaattgaagccattaaatggaatttcaccaaatttctagttgatcgc
agtggcaaagtcgttaaacgctatcctcccaccaccaaacctgaagatatagccaaagat
attcaagcattactataa

DBGET integrated database retrieval system