KEGG   Cyanothece sp. PCC 8801: PCC8801_3930Help
Entry
PCC8801_3930      CDS       T00806                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cyp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PCC8801_3930
   01230 Biosynthesis of amino acids
    PCC8801_3930
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC8801_3930
   00030 Pentose phosphate pathway
    PCC8801_3930
   00051 Fructose and mannose metabolism
    PCC8801_3930
   00052 Galactose metabolism
    PCC8801_3930
  Energy metabolism
   00680 Methane metabolism
    PCC8801_3930
Enzymes [BR:cyp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PCC8801_3930
Protein phosphatases and associated proteins [BR:cyp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PCC8801_3930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4115497..4116579
Genome map
AA seq 360 aa AA seqDB search
MGEKKRIGILTSGGDCAGLNAVIRAVVHHAMGTYGWEVVGIREATHGLMTRPPQVMEFEL
DKLDSLLLMGGTILGTTNKGDPFAFPMGDGTLRDRSQEIIDGYHSLGLDALIGIGGDGSL
AILRRLAQQGGINLVGIPKTIDNDVGATEVSIGFDTATNIATEALDRLHFTAASHNRVMI
LEVMGRDAGHIALAAGIAGGADIILIPEIPYQMENVCQKIRQRQEMGKNFCLVMVSEAVR
TEVGDQLTELKAAGEDRLGGIGKYLAEQIALKTGAETRVTVLGHIQRGGMPSPVDRLLGS
AFGVAAVDLIAQGKYDQMVAWQNRQIVSVPIAEAINTYRSVDPEETLVKTARGLGICLGD
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaaaaaaacgaattgggattctcaccagtggcggtgattgcgcgggattaaat
gccgttattagagccgttgttcaccatgcgatgggaacctacggttgggaagtggtgggt
attcgggaagcaacccacgggttgatgactcgtcctccccaggtgatggagtttgaactc
gataaactggactccttgttgttaatgggaggaactatcctaggaaccactaataaaggc
gatccttttgcttttccgatgggagatggaaccctacgcgatcgctctcaagaaattatc
gacggctatcatagtctggggttagatgcgctcattggtattggtggggatggcagttta
gccattttacggcgtttagctcaacaaggggggatcaatctcgtggggattcccaaaacg
attgataatgatgtaggagccacagaagtctccattggctttgatacggcgaccaatatt
gcgacagaagcccttgatcgtctccattttaccgcagccagccataatcgggtcatgatt
ttggaagtcatgggacgcgatgctggacatatcgccttagcggcgggtattgcgggggga
gccgatattattttaattcccgaaattccctaccaaatggaaaatgtttgccagaagatt
cgccaaagacaggaaatgggcaaaaatttctgtttagtcatggtttccgaagctgtccgc
acagaagtcggggatcaactaacggaactcaaagcagccggagaagatcgcctaggggga
attggtaagtatctggccgaacaaattgccctcaaaacgggtgcagaaacccgtgtaacg
gtcttgggacacattcaacgaggggggatgccttctcctgttgatcgtctgttaggatcg
gcatttggagtcgctgcggtggatttaattgcccaaggaaaatatgaccagatggtggct
tggcaaaaccgacagatcgtcagtgttcccattgctgaggccattaatacctatcgcagt
gttgaccctgaagaaactttggttaaaactgccagaggattaggcatttgtttaggagat
taa

DBGET integrated database retrieval system