KEGG   Cyanothece sp. PCC 8801: PCC8801_3940Help
Entry
PCC8801_3940      CDS       T00806                                 

Definition
restriction modification system DNA specificity domain-containing protein
Orthology
K01154  
type I restriction enzyme, S subunit [EC:3.1.21.3]
Organism
cyp  Cyanothece sp. PCC 8801
Brite
Enzymes [BR:cyp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.3  type I site-specific deoxyribonuclease
     PCC8801_3940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4125145..4126506
Genome map
AA seq 453 aa AA seqDB search
MTLNTLKQWKPYPHYKPSGVDFLGDIPDGWEVKRLKWIVSKIGSGKTPKGGAEIYSDSGI
IFLRSQNIHFDGLRLDDVVYINKDIDKAMSSSRVKPLDILLNITGASLGRCMIIPKDFPS
SNVNQHVCILRPIVTRINPYFLNRVMSSNAIQNQIFSSEVGVSREGLTFAQAGNLISVFP
SLPEQEKIAQFLDEETAKIDKLITHKQRLIELLKEKRTALISHAVTKGLNPDVPMKDSGV
EWLGFIPEHWEVKKIKRLSLVKRGASPRPIDDPIYFDDNGEYVWVRISDVTASNKYLLEA
EQKLSEIGKRKSVPLQPNELFLSICASVGKPIITKIKCCIHDGFVYFPELKENREYLYYI
FLGGELYKGLGKMGTQLNLNTEIIGDVKLPIPPVSEQQKIAEYLDEKTEQIDPIIKKTRE
SIEYLKEYRTALISAAVTGKIDVRQWGCEEVRE
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaccctaaataccctaaagcaatggaaaccttacccacattataaaccttccggggtt
gatttcttgggggatattcctgatgggtgggaggttaaaagattaaaatggattgtatca
aaaattggtagcggtaaaactcctaaaggtggtgcagaaatttactctgattctggtatt
atttttttgcgtagccagaatattcattttgatggtttaagattagatgacgttgtttat
ataaataaagatattgataaagcaatgtcatcttctagagtaaaaccgcttgacattctt
ttaaatataacaggcgcatctttagggagatgtatgattattcctaaagatttcccgtca
tctaatgttaatcagcacgtttgcattcttagacctattgtaacccgtatcaacccttat
tttttaaatagagtaatgtcctctaatgcaattcaaaatcaaatattttcttctgaagtt
ggtgtttcccgtgaaggtttaacttttgctcaagctggtaatttaatttcagtatttccc
tccctacccgaacaagaaaaaatcgctcaatttctggatgaagaaaccgcgaaaatagat
aaactcatcacccacaaacaaagactaattgaattattaaaagaaaagcgcacagcttta
attagtcatgctgtcaccaaaggacttaaccccgatgtcccgatgaaagattctggggta
gaatggttagggtttattcctgaacattgggaggttaagaaaattaagaggttatcctta
gtaaaaaggggcgcatcacctagaccaattgacgacccaatatattttgatgataatgga
gaatatgtatgggttagaatttctgatgtaacagctagtaataaatatttattagaagct
gaacaaaaattatccgagataggaaagaggaaaagtgttcctttacaacctaatgaacta
ttcttaagcatttgcgctagtgttggaaaaccaatcattaccaaaattaaatgctgtatt
catgatggttttgtgtattttccagaattgaaagaaaatagagaatatttatattatatt
tttctgggaggagaattatataaaggtttaggtaaaatgggaacacagttaaatcttaat
acggagattattggagatgttaaattaccaattcctcccgtttccgaacaacaaaaaatc
gcagaatacttagacgaaaaaaccgaacaaatagacccaataattaagaaaacccgtgag
agtatcgagtatttaaaagaatatcgaaccgcgttaatatctgctgccgtaacaggtaaa
atagatgtgaggcagtggggatgtgaggaggtgagggaatga

DBGET integrated database retrieval system