KEGG   Cyanothece sp. PCC 8801: PCC8801_4022Help
Entry
PCC8801_4022      CDS       T00806                                 

Definition
phosphodiesterase/alkaline phosphatase D-like protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cyp00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:cyp00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:cyp02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4213569..4215290)
Genome map
AA seq 573 aa AA seqDB search
MPNIASGDTNQNSSVLWTQSNYTGKVTFEYSTDPNFTTIAGSITQTITDINLPVKVSVTD
LSPGTQYYYRVTDANSQTTLGTFKTAAEIGQQKGLKFGVSGDWRGELSPYPAIANADEQN
LDFFILHGDTIYADYPSPAVNKSQAETITDFRLKYQEVYGDRFGLNTWGDLRSSTSIFAT
IDDHEVTNDFAGGADVSTDSRFSDSPGILINESTLYQTGLQAFQEYHPIKNQTYANTGDR
RTENKPKLYRSTTYGKDAQIIILDNRSFRDQTLPNVTNPSDSTQVNQFLTNSFNPSRTML
GKAQLDDLKHDLLTAHNKGVTWKFILVPEPIQNLGVIFASDRFEGYAAERTEILKFIDEN
NINNVVFIAADIHGNLVNNLTYQLSPNSQQIPTNSFEVTTGSVAFNAPFGPSVIGLASQL
KRLTPQQVAFYNSLTTRDAKDNFIRQLVDQQITPFGYDPLGLDNNLSQANGLINAQLIQG
GYVNTHTYGWTKFDIDQNTQKLTVTTYGIDPYTEAELTPNSPVLTRNPVIINQFEVTPTK
TPKPSFSLSLLIVFAICSLCFLPSIISSIFKEK
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgcctaatattgccagtggagatactaaccaaaattctagtgttttatggacgcaaagt
aattatactggaaaggttacttttgagtattcaaccgatcctaatttcacaacaattgca
ggaagtattacccaaaccataaccgatattaatcttccagttaaggtttctgtgacggat
ttaagcccaggaactcaatattattatcgagttactgatgctaacagccaaaccaccctt
gggactttcaaaacggcggcagaaattggacaacaaaaggggttaaaatttggcgtttct
ggagactggagaggtgaattaagtccctatccagctattgccaatgctgatgaacaaaac
ctagactttttcatcttgcacggcgatacaatttatgctgattatccctcccctgctgtt
aacaaatcccaagcagaaaccataacagattttcgtctaaaatatcaagaagtttatggc
gatcgcttcggactaaatacttggggagacttgcgatcttctacctcaatttttgctacc
attgatgaccacgaagtgaccaatgatttcgcaggaggggctgatgtttccaccgattca
agatttagcgattccccaggaatattgattaatgaaagtactctttatcagactgggtta
caagcgtttcaagaataccatcctatcaaaaatcaaacctatgctaacacgggcgatcgc
cgtactgaaaataaacctaaattgtatcgttctacaacctatggtaaggatgcccagatt
atcattttagataaccgttcttttcgagatcaaaccctacctaatgttaccaatcctagc
gattcaacacaagtaaatcaatttctcaccaattcctttaacccttctcgaaccatgtta
ggaaaggcgcaacttgatgatcttaaacatgatttattgacggcacacaataagggagtg
acttggaaatttattctggttcctgaacctatccaaaatttaggggtaatctttgcttca
gatcgctttgaaggttacgccgcagaacgaaccgaaatcctcaaattcattgatgaaaat
aacattaataatgttgtctttattgcggcggacattcatggtaatttagtcaataattta
acctatcaactctctcccaatagccaacaaattcctaccaattcctttgaagtgaccacg
ggatcggttgcttttaatgccccctttggtccgagtgtcattgggttagcttctcagtta
aaacgattaactcctcaacaggttgctttttataattccctcacaacaagggatgctaaa
gataattttattcggcaattagttgatcaacaaatcacaccttttggctacgatcctttg
gggttagataacaatttatctcaggctaacggattaattaatgctcaacttattcaagga
ggatatgttaacacccacacctacggttggacaaaatttgacatcgatcaaaatactcaa
aaattgacagtaaccacctatggcattgatccctatactgaggctgaactgacaccaaat
agtccagttttaacgagaaatcctgtgattatcaatcaatttgaggtaactcctacaaaa
acccctaaaccttccttctctttaagtttattaatagtttttgctatctgtagtttatgc
tttttaccctcaattatctcatcaatttttaaggagaaataa

DBGET integrated database retrieval system