KEGG   Cyanothece sp. PCC 8801: PCC8801_4160Help
Entry
PCC8801_4160      CDS       T00806                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:cyp02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:cyp02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4362270..4362788
Genome map
AA seq 172 aa AA seqDB search
MTTLNDTDNSLSLIVGVGASAGGLDAFSELLSHLPTDTGMGFVLVQHLSPGQESLLSELL
ARTTRMPVATAENGMTVEANHVYVIPPNAQMTIAEGQLQLAACDQLQGRIKTIDVFFESL
AADQKNKAIALSGYADPRSIGASLEAGFQEYLSKPVDINELISSVSALSRRQ
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgactacgttaaatgatacagacaatagtctctcgctaattgtaggggttggagcatct
gcgggggggctagatgccttttcggaactgctcagtcatttacccaccgataccgggatg
gggtttgtgctggtgcagcatctttcccctggacaggagagcctattaagcgagttattg
gcacgcaccacgcgaatgccagtcgccaccgccgaaaatggcatgacggtagaggccaat
catgtctatgtgatcccccccaatgctcagatgaccatcgccgagggacaactgcaatta
gctgcttgtgatcaactccagggacggattaaaaccattgatgtcttttttgaatcctta
gcagccgatcaaaaaaataaagcgatcgccctatcaggctacgccgatccacgaagtata
ggggcttctctcgaagcaggttttcaggagtacctgagcaaaccagtcgatataaacgaa
ttgatatcttctgtatctgctctttctaggaggcaataa

DBGET integrated database retrieval system