KEGG   Cyanothece sp. PCC 8801: PCC8801_4320Help
Entry
PCC8801_4320      CDS       T00806                                 

Definition
magnesium chelatase subunit H (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cyp00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4537003..4540995
Genome map
AA seq 1330 aa AA seqDB search
MFTHVKSTIRHIVPKAINGRSLLKVVYVVLEPQYQSSLSAAVNAINSNNPKLAIEISGYL
IEELRNPENYEEFKRDIANANLFIASLIFIEDLADKVVEAVKPHRDNLDAVVVFPSMPQV
MRLNKLGSFSMAQLGQSKSAIAQFMRKRKENSGAGFQDAMLKLLRTLPQVLKYLPVEKAQ
DARNFMLSFQYWLGGSAENLENFLLMLAHKYSYPDLLQDKTVDYKDPVVYPDMGIWHPLS
MQMFEDVPSYLQWFNSRTDISDNLKDPLAPCVGLILQRTHLVTGDDAHYVAMVQELECMG
ARVIPVFAGGLDFSKPVEAYFWDRSVKGIEPVAIVDTVVSLTGFALVGGPARQDHPKAIE
SLKRLNRPYMCALPLVFQTTQEWEASDLGLHPIQVALQIAIPELDGAIEPIILSGRDGNT
GRAIALQDRIEAVAQRALKWANLRKKPKLDKKVAITVFSFPPDKGNVGTAAYLDVFGSIY
EVMKALKGNGYDVQELPDSPKALMEAVIHDAQAQYASPELNIAYRMSVEQYERLTPYSVR
LEENWGPPPGHLNSDGQNLLIYGKQFGNVFIGVQPTFGYEGDPMRLLFSRSASPHHGFAA
YYTYLNQVWKADAVLHFGTHGSLEFMPGKQMGMSGECYPDSLIGMIPNLYYYAANNPSEA
TIAKRRSYAETISYLTPPAENAGLYKGLQELSELIGSYQTLKDSGRGIPIVNTIMDKSRL
VNLDQDIALPDTDAKDMTSEERDNIVGLVYRKLMEIESRLLPCGLHVIGKPPSAEEAIAT
LVNIAALDREEEGITSLPRIIANSVGREIEEVYQNSDRGILEDVELLQQITLATREAVSA
LVKEQIDAEGRVSFVSKLNFFNMGKKTPWVETLHNLGYKNVDQDALKPLFEYLEFCLEQV
CADNELGGLLKALEGEYVLPGPGGDPIRNPNVLPTGKNIHALDPQSIPTLAAVKSAKIVV
DRLLARQKIDNGGNYPETIACVLWGTDNIKTYGESLAQIMWMVGVKPVPDALGRVNKLEL
ISLEELGRPRIDVVVNCSGVFRDLFINQMNLLDQAVKMAAEANEPLEMNYVRKHALQQAE
EMGINLRQAATRIFSNASGSYSSNVNLAVENSSWEEEKELQDMYLNRKGFAFDSDNPGVM
NDNRKVFEAALKTADATFQNLDSSEISLTDVSHYFDSDPTKVVASLRGDGKKPAAYIADT
TTANAQVRTLSETVRLDARTKLLNPKWYEGMLSHGYEGVRELSKRLVNTMGWSATADAVD
NWVYEDVNTTFIQDEEMCKRLMNLNPNSFRKMVGTLLEVNGRGYWETSQENLDKLQELYQ
EVEDRIEGVE
NT seq 3993 nt NT seq  +upstreamnt  +downstreamnt
atgtttacccacgtcaagtccaccattcgccatatcgttccaaaggcaattaatggtcgt
tctttgcttaaggtggtctatgtcgtcttagaacctcagtatcagagttctctatcggcg
gctgttaatgctatcaatagtaataatcccaagttagccatagaaattagtggttattta
atcgaagaactgagaaaccccgaaaactacgaggaatttaaacgagatatagctaatgca
aacctttttatcgcgtcgttgatcttcattgaagacctagcggataaagtggtcgaagca
gtcaaaccccatcgggataacttagatgcggtggttgttttcccctccatgccccaggta
atgcgcttaaataaattgggtagcttttccatggcacagttgggacagtctaagagtgcg
atcgcccaatttatgcgaaaacgcaaagaaaattcgggtgcagggttccaagatgccatg
ttaaagctattgcggacgcttccccaagttttgaagtatcttcccgtggaaaaggcgcaa
gatgctcgcaactttatgctaagttttcagtattggttagggggatcggcagaaaattta
gagaatttcctgctaatgttggcgcacaagtattcctaccccgacttactccaagataag
actgttgactataaagatcccgtcgtttatcccgatatgggaatatggcatcccctctcg
atgcaaatgttcgaggatgtcccttcctatctacaatggttcaacagtcggacggatatc
tccgataacctcaaagatcccttggccccttgtgttggtttaattttacaacgaacccat
cttgtaaccggagatgatgctcactatgtagccatggtacaggaattagagtgcatggga
gcaagagttattcccgtatttgcaggggggttagacttttctaaacccgtggaggcctat
ttttgggatcgcagcgtcaaagggatagaacctgtagctattgtagacaccgttgtatcc
ttaacagggtttgccttagtcggtggtcctgcgcgtcaagaccatcctaaagcgatagaa
tcattaaaacgcctcaaccgtccctatatgtgtgcgttacctctcgtcttccaaaccacc
caagaatgggaagcaagcgatttagggttacatccgatccaagttgccttacaaattgct
atccctgagttagacggtgctattgaacccattatactctcaggacgggatggtaatacg
ggacgagcgatcgcccttcaagatcgtatcgaagcggtggcacaacgggcattaaaatgg
gctaatctacggaaaaaacctaaattagacaagaaagtcgctattaccgtctttagcttc
cctcccgataaaggaaacgtgggaaccgcagcctatttagacgtatttggctctatttac
gaggtaatgaaggcattaaaaggcaatgggtacgatgtgcaagaattacccgactccccc
aaagctttgatggaagcggtgatccacgatgcacaagcgcagtatgcgtcccctgagttg
aatatagcctatcggatgtcggtggaacaatacgaacggttaaccccctattcggttcgt
ttagaagaaaattggggtcctcctccgggtcatttaaacagtgacggacagaatttatta
atctatggcaaacagtttggtaacgtctttattggggttcaaccaacttttggttatgaa
ggtgatcccatgcggttactattctcaagatcggccagtccccatcatggttttgctgcc
tattacacctatttaaaccaagtttggaaagcggatgcggtgttgcattttggaacccat
ggatcactggaatttatgccagggaaacagatgggaatgtcgggagaatgttaccctgat
agtttgattggaatgatccccaatttgtattattatgcggcgaataatcctagtgaagca
accattgctaaacgtcgcagctatgcggaaaccatctcctatttaacccctcctgcggag
aatgcagggttatacaaaggactgcaagaattaagtgaattaatagggtcataccaaacc
ctcaaagatagcggacggggtatccctattgttaacaccatcatggataaatctcgctta
gtcaatttggatcaggatattgcattacctgacaccgatgctaaagatatgacctccgaa
gaacgggataatattgtcggtttggtttaccgaaaattgatggaaattgagtcccgtttg
ttgccttgtggccttcatgttattggtaaacctccctccgcagaagaagcgatcgcaacg
ttagtcaatattgctgctttagaccgtgaagaagaaggaattacctccttaccccgtatt
attgctaacagtgtgggacgggaaattgaggaagtttatcaaaacagcgatcgcggtatt
ctagaagatgtggaattactgcaacaaattaccctagcaacccgtgaagcagtgtctgct
ttagtcaaagaacaaatagatgcagaaggacgagtttcctttgtttctaaactcaatttc
tttaacatgggtaaaaagacaccttgggtcgaaaccctccataatttagggtataaaaat
gtcgatcaggatgccttaaaacccctctttgaatacctagaattttgtttagaacaggtt
tgtgccgataacgaattaggagggttactaaaagcattagaaggggaatatgtgttacca
ggtcctggaggtgatcccatccgtaaccccaacgttttacccactggtaaaaacatccac
gcattagacccccaatctatccccaccttagctgccgttaagtctgctaaaattgtcgta
gatcgattattagcacggcaaaaaattgataatggtggcaattatcccgaaaccattgct
tgcgttttgtggggaacggataacatcaaaacctacggggagtccctcgcacaaatcatg
tggatggtaggggttaaacccgttcccgatgcgttaggacgagtcaacaaattagagtta
atttccctcgaagaattaggacgacctcgtattgatgtagtggtcaactgttcgggagtg
ttccgtgacctatttattaaccaaatgaacttattagatcaagcggttaaaatggcagca
gaagcaaacgaacccctagagatgaactacgtccgtaaacacgctttacagcaagcagaa
gaaatgggaattaacctgcgtcaagcagcaacccgcatcttttctaacgcttctggttcc
tattcgtctaacgtcaatttagcggtagaaaatagcagttgggaagaagaaaaagagtta
caagatatgtatctcaaccgcaaagggtttgccttcgactctgataacccaggggtcatg
aatgacaaccgtaaagtgtttgaagctgcattaaaaacagccgatgcaaccttccaaaac
ttagattcttccgaaattagtttaacggatgtttcccattatttcgactctgatcccaca
aaagtagtggcaagtttacggggagatggtaaaaaaccggccgcgtatattgccgataca
actaccgcaaacgcacaggttcggaccttatcagaaaccgtccgtttagatgcgcgtacc
aaattattaaaccctaaatggtacgagggaatgttatcccacggttacgaaggagtaagg
gaactttctaagcggttagtcaatacaatgggatggtctgcaactgctgatgcggtagat
aattgggtctatgaagacgtaaatacaacctttattcaagatgaggaaatgtgtaaacgt
ctgatgaatttaaaccccaattctttccggaaaatggtcggtactttattagaagttaat
ggccgcggttactgggaaacatcacaggaaaacttagacaagttacaggaattgtatcag
gaggttgaggacagaattgaaggagtagagtaa

DBGET integrated database retrieval system