KEGG   Cycloclasticus sp. P1: Q91_0096Help
Entry
Q91_0096          CDS       T02265                                 

Gene name
folK-2
Definition
7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cyq  Cycloclasticus sp. P1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Q91_0096 (folK-2)
Enzymes [BR:cyq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Q91_0096 (folK-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(103092..103583)
Genome map
AA seq 163 aa AA seqDB search
MTTVYLSIGSNIEREKHIRAGINALKKQFGNLTLSSVYESDAVGFDGQPFLNLIAAFETD
LSAIQVDTILDTIEKDNGRTLDQKKFNPRTLDLDLILYGNFISKDPLLDIPRGEITQYAF
VLEPLAEIAGNLQHPVLQTSYQQLWQHFDKSNIVQKRIDFSWD
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaccactgtttacctaagcattggcagcaacattgagcgcgaaaaacatatccgtgcc
ggtataaatgccttaaaaaaacaattcggcaacctcaccttatccagcgtttatgagtcc
gacgcggttggttttgatggtcaaccctttctaaatttaattgctgcttttgaaacagac
ctgtccgcaatacaagtagataccattcttgatacgattgaaaaagacaatggccgcacc
cttgatcagaaaaaatttaacccgcgaacactggatttagatttaatcctgtatggcaac
ttcatcagcaaagaccctcttctcgatattccgcgtggtgaaataactcagtacgcattc
gtcttagagccactggctgaaattgctggcaacctacaacatcctgttttacagacctct
taccagcagctctggcaacatttcgacaaatctaacatcgtacaaaaacgcattgatttt
agttgggattag

DBGET integrated database retrieval system