KEGG   Cycloclasticus sp. P1: Q91_0296Help
Entry
Q91_0296          CDS       T02265                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA ligase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cyq  Cycloclasticus sp. P1
Pathway
cyq00020  Citrate cycle (TCA cycle)
cyq00640  Propanoate metabolism
cyq00660  C5-Branched dibasic acid metabolism
cyq01100  Metabolic pathways
cyq01110  Biosynthesis of secondary metabolites
cyq01120  Microbial metabolism in diverse environments
cyq01130  Biosynthesis of antibiotics
cyq01200  Carbon metabolism
Module
cyq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cyq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cyq00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Q91_0296 (sucC)
   00640 Propanoate metabolism
    Q91_0296 (sucC)
   00660 C5-Branched dibasic acid metabolism
    Q91_0296 (sucC)
Enzymes [BR:cyq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Q91_0296 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AFT66336
UniProt: K0C3P2
Position
307585..308745
Genome map
AA seq 386 aa AA seqDB search
MNLHEYQAKQVFAEFGVPVPVGKPARSVKEAVNVAKELGGECWVVKAQVHAGGRGKAGGV
KLCKGIDEVEAFSKKLLGSRLVTPQTDEEGLPIEMLIVEEVKPIDRELYISAVVDRGTKR
IMFMASEAGGMDIEEVAEETPEKILLAAVDPVAGLQPYQARDIAFKMGLKGKQVGQLFKV
MSGILAVFWAKDASQVEINPLIVNGDGDLVALDAKVNLDDNAAYRNADMVAMRDPSQEDE
KEHAAQQHELNYITLNGSIGCMVNGAGLAMATMDLVKLEGGFPANFLDVGGGATAERVAE
AFKLILSDDKVKVVLVNIFGGIVRCNLIAEGIIEAVKEVGVSVPVVVRLEGTNADQGRQL
LKDSGLDIIAADDLTLAAKAAVKAAS
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacatgaataccaagcaaaacaggtgtttgctgagtttggtgtacccgtacca
gttggtaagccagcacgttcagttaaagaagctgtcaatgttgcaaaagagttaggcggt
gagtgttgggtagttaaagcccaagttcacgcaggtggtcgtggtaaagcgggtggcgtt
aaattgtgtaaagggatagacgaggtagaagcgtttagcaaaaagctattgggctctcgc
ttggtgacgccacaaaccgatgaagaaggtttgcctatcgaaatgcttattgtcgaggaa
gttaagcctatcgatcgcgagctttatattagcgctgtggttgatcgtggcactaaacga
attatgtttatggcgtctgaagcaggcggtatggatattgaagaagtggcggaagaaaca
ccagagaagattttattagccgccgttgatcctgttgctggcttacagccgtatcaagcg
cgcgatatagcttttaaaatggggcttaaaggtaaacaagttgggcagctgtttaaagtc
atgtctggcattttagccgttttttgggcaaaagatgcgagccaagttgaaatcaaccca
ctgattgttaatggtgatggtgacttagtcgcactagatgcaaaagttaatttagatgat
aacgccgcttatcgtaacgccgatatggttgccatgcgtgatccgtcgcaagaagatgaa
aaagagcatgcagcacaacaacatgagttgaactatattacgttgaacggcagcattggt
tgtatggtgaatggtgcaggtttagcgatggcgactatggacttagttaaattggaaggt
ggtttccccgctaacttcttagatgtaggtggtggcgcaacagctgaacgtgtggctgaa
gcgtttaaacttattttgtctgatgacaaagtaaaagtagtgttagtgaatatttttggc
ggcatcgttcgttgtaacttaattgctgaaggtattattgaagcggttaaagaggtaggt
gttagcgtaccggtagtggttcgtttagaaggcactaatgccgatcaagggcgtcagcta
ttgaaagattctggtttagatattattgccgctgatgatttaaccttggctgctaaagcc
gctgttaaagcagcatcttaa

DBGET integrated database retrieval system