KEGG   Cycloclasticus sp. P1: Q91_0397Help
Entry
Q91_0397          CDS       T02265                                 

Definition
(GenBank) DNA polymerase III, chi subunit superfamily
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
cyq  Cycloclasticus sp. P1
Pathway
cyq00230  Purine metabolism
cyq00240  Pyrimidine metabolism
cyq01100  Metabolic pathways
cyq03030  DNA replication
cyq03430  Mismatch repair
cyq03440  Homologous recombination
Module
cyq_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:cyq00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Q91_0397
   00240 Pyrimidine metabolism
    Q91_0397
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Q91_0397
   03430 Mismatch repair
    Q91_0397
   03440 Homologous recombination
    Q91_0397
Enzymes [BR:cyq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Q91_0397
DNA replication proteins [BR:cyq03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Q91_0397
DNA repair and recombination proteins [BR:cyq03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     Q91_0397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: AFT66437
UniProt: K0C420
Position
complement(413301..413723)
Genome map
AA seq 140 aa AA seqDB search
MTRIDFYVLPDDTPDAQHLFACRLAQKASKQGHRVYIHTDSEQQSKTVDDLLWSFSPTSF
VPHTMDPTKCANHPVYINHTGDPLDIHDVLINLTEKTPDCFARFERFAELVNQNESIKQA
GRERFKFYKSRGYPLQTHKI
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgaccagaatcgacttttatgtactgccagatgacacccctgatgcacagcaccttttt
gcctgtcggctagctcaaaaagctagcaaacagggtcatcgcgtgtatattcataccgat
tcagaacaacaatccaagacagtggatgacttgctttggtccttctcgcccaccagtttt
gtaccacatactatggacccaacaaagtgcgccaaccacccagtgtacattaaccacact
ggtgacccgttagatattcacgacgtgctaattaaccttactgagaaaacacccgattgt
tttgctcggtttgaacgatttgctgagcttgttaatcaaaatgaatcaattaaacaagca
ggacgggagcggtttaagttttataaaagcagagggtatccactgcagacgcataaaatt
tga

DBGET integrated database retrieval system