KEGG   Cycloclasticus sp. P1: Q91_0397Help
Entry
Q91_0397          CDS       T02265                                 

Definition
DNA polymerase III, chi subunit superfamily
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
cyq  Cycloclasticus sp. P1
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cyq00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cyq00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:cyq03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:cyq03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cyq03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(413301..413723)
Genome map
AA seq 140 aa AA seqDB search
MTRIDFYVLPDDTPDAQHLFACRLAQKASKQGHRVYIHTDSEQQSKTVDDLLWSFSPTSF
VPHTMDPTKCANHPVYINHTGDPLDIHDVLINLTEKTPDCFARFERFAELVNQNESIKQA
GRERFKFYKSRGYPLQTHKI
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgaccagaatcgacttttatgtactgccagatgacacccctgatgcacagcaccttttt
gcctgtcggctagctcaaaaagctagcaaacagggtcatcgcgtgtatattcataccgat
tcagaacaacaatccaagacagtggatgacttgctttggtccttctcgcccaccagtttt
gtaccacatactatggacccaacaaagtgcgccaaccacccagtgtacattaaccacact
ggtgacccgttagatattcacgacgtgctaattaaccttactgagaaaacacccgattgt
tttgctcggtttgaacgatttgctgagcttgttaatcaaaatgaatcaattaaacaagca
ggacgggagcggtttaagttttataaaagcagagggtatccactgcagacgcataaaatt
tga

DBGET integrated database retrieval system