KEGG   Cycloclasticus sp. P1: Q91_0559Help
Entry
Q91_0559          CDS       T02265                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase 2
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cyq  Cycloclasticus sp. P1
Pathway
cyq00010  Glycolysis / Gluconeogenesis
cyq00620  Pyruvate metabolism
cyq00640  Propanoate metabolism
cyq00680  Methane metabolism
cyq01100  Metabolic pathways
cyq01110  Biosynthesis of secondary metabolites
cyq01120  Microbial metabolism in diverse environments
cyq01130  Biosynthesis of antibiotics
cyq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cyq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Q91_0559
   00620 Pyruvate metabolism
    Q91_0559
   00640 Propanoate metabolism
    Q91_0559
  Energy metabolism
   00680 Methane metabolism
    Q91_0559
Enzymes [BR:cyq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Q91_0559
Lipid biosynthesis proteins [BR:cyq01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Q91_0559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N Toprim_2
Motif
Other DBs
NCBI-ProteinID: AFT66597
UniProt: K0C4I6
Position
566147..568087
Genome map
AA seq 646 aa AA seqDB search
MSDVHIHKVPKAVADHAHINKEVYEAEYQRSIEDTKGFWDEKAREFLTWSKPWDVTVEHD
FPKGEVKWFTGGKLNVSVNCLDRHLETRGDQPAIIWESDDPAVDKTYTYKELHAEVCRFA
NGLKAEGVKKGDRVCIYMPMVAEAAIAMLACARIGAVHLVVFGGFSPDALKDRLLDSEAA
VIIVADESVRGGKAVPLKANADQALKSCPSVKSVVVVQRTGGSIDWTDGRDVWYHDLLEN
ASDDCPAEEMDSEDPLFILYTSGSTGKPKGVLHTTGGYLLHAAVSHKYVFDYHDGDVYWC
TADVGWVTGHTYIVYGPLANGAQTLMFEGVPTYPDASRFWKVVEKHKVNIFYTAPTAIRA
LMAKGDDYVKTCDLSSLRVLGSVGEPINPEAWEWYHKVIGGGRCPIVDTWWQTETGGILM
TPLPGATDLKAGSAMQPFFGIEFGLVDNEGNEVTGNPAEGILVIKKPWPGMFRTLFGDHQ
RYIDAYFANYPGMYFPGDGARRDKDGDYWITGRVDDVINVSGHRMGTAEVESALVLHPAV
AEAAVIGYPHDIKGQGIYTFVTLMDGVEATDELRQELVNHVRKEIGPIASPDVIQWAPGL
PKTRSGKIMRRILRKISENLIDELGDTSTLADPSVVDDLIANRPSQ
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacgttcatatacacaaagtacccaaagcggtagctgatcatgcgcatattaat
aaggaagtatatgaagctgagtatcaacgctcaattgaagatactaagggtttttgggat
gaaaaagcgagagagtttttaacttggtcaaagccatgggatgtaacagtagagcatgat
tttccaaaaggtgaggttaaatggtttactggaggcaagctcaatgtaagtgttaattgc
ttggatcggcatcttgaaacgcgtggcgatcagccagctattatttgggaaagtgatgat
ccggcagtcgataaaacatatacttataaagagcttcatgcggaggtgtgtcgctttgct
aatggtttaaaagccgagggtgtaaaaaaaggtgaccgtgtttgtatttatatgccaatg
gttgctgaagctgccattgcaatgcttgcgtgcgcaagaattggtgcggttcatctagtt
gtttttggtggtttttcccctgatgcgttaaaagataggcttcttgattcagaagcggcg
gtaattattgtcgccgatgaaagtgttcgtggaggtaaagcagtaccgttaaaggctaat
gcggatcaagccttaaaaagttgcccttcagtaaaatcagtggtggtggttcaacgtaca
ggtggcagtatagattggacagatggtcgagatgtttggtatcacgatttacttgagaat
gcgtcagatgattgcccagctgaagaaatggactctgaagatcccttgtttatcctttat
acatcgggctcaacaggcaaaccaaaaggtgttttacatacgacgggtggctatttgcta
catgctgcggtgtcgcacaaatatgtttttgactatcacgatggggatgtttactggtgt
acagcggatgtaggctgggtaacggggcatacatacattgtttatgggccattagcgaat
ggtgcgcaaacgttgatgtttgaaggcgtgccaacttatcctgatgcttcgcgcttttgg
aaagtggtggaaaagcataaagttaatattttttacacggcacctacggctattcgtgcc
ttgatggctaaaggtgatgattatgtaaagacttgcgacttaagtagtctaagagttctg
ggtagtgtgggtgagccgattaacccagaagcttgggagtggtatcacaaggtgattggc
ggtggtcgttgcccgattgtggatacttggtggcaaacagaaacgggcgggattttaatg
acaccccttccgggagcgactgacctgaaagccggttcggcgatgcagcctttctttggt
atagagtttggtttggtagataacgaaggtaatgaagtaacgggaaatcctgccgaaggg
attttagtgattaaaaaaccatggcctgggatgtttagaacattgtttggtgatcatcag
cgttatattgatgcttattttgcgaattatcctgggatgtattttcctggtgatggtgca
cgacgagataaagatggagattattggattaccggtagggttgatgatgtgattaatgtg
tctggtcacaggatgggtaccgcagaagttgagagcgccttagtgcttcatccagcagtg
gctgaggcggcggttattggttatcctcatgatataaaggggcaaggtatttatactttt
gtgaccttgatggatggggtcgaagcaacggatgaattacgtcaagagttagtgaaccat
gtgcgtaaagagatagggccaatagcctcgcctgatgttattcaatgggcgccaggctta
cctaaaacacgctcaggtaaaattatgcgtagaattttacgtaaaatttctgaaaacttg
attgatgaattaggcgatacatcgaccttggctgatccatcagtcgtcgatgaccttatc
gcgaatcgccctagtcaataa

DBGET integrated database retrieval system