KEGG   Cycloclasticus sp. P1: Q91_0559Help
Entry
Q91_0559          CDS       T02265                                 

Definition
acetyl-coenzyme A synthetase 2
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cyq  Cycloclasticus sp. P1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cyq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Q91_0559
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Q91_0559
   00620 Pyruvate metabolism
    Q91_0559
   00640 Propanoate metabolism
    Q91_0559
  Energy metabolism
   00680 Methane metabolism
    Q91_0559
Enzymes [BR:cyq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Q91_0559
Lipid biosynthesis proteins [BR:cyq01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Q91_0559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
566147..568087
Genome map
AA seq 646 aa AA seqDB search
MSDVHIHKVPKAVADHAHINKEVYEAEYQRSIEDTKGFWDEKAREFLTWSKPWDVTVEHD
FPKGEVKWFTGGKLNVSVNCLDRHLETRGDQPAIIWESDDPAVDKTYTYKELHAEVCRFA
NGLKAEGVKKGDRVCIYMPMVAEAAIAMLACARIGAVHLVVFGGFSPDALKDRLLDSEAA
VIIVADESVRGGKAVPLKANADQALKSCPSVKSVVVVQRTGGSIDWTDGRDVWYHDLLEN
ASDDCPAEEMDSEDPLFILYTSGSTGKPKGVLHTTGGYLLHAAVSHKYVFDYHDGDVYWC
TADVGWVTGHTYIVYGPLANGAQTLMFEGVPTYPDASRFWKVVEKHKVNIFYTAPTAIRA
LMAKGDDYVKTCDLSSLRVLGSVGEPINPEAWEWYHKVIGGGRCPIVDTWWQTETGGILM
TPLPGATDLKAGSAMQPFFGIEFGLVDNEGNEVTGNPAEGILVIKKPWPGMFRTLFGDHQ
RYIDAYFANYPGMYFPGDGARRDKDGDYWITGRVDDVINVSGHRMGTAEVESALVLHPAV
AEAAVIGYPHDIKGQGIYTFVTLMDGVEATDELRQELVNHVRKEIGPIASPDVIQWAPGL
PKTRSGKIMRRILRKISENLIDELGDTSTLADPSVVDDLIANRPSQ
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacgttcatatacacaaagtacccaaagcggtagctgatcatgcgcatattaat
aaggaagtatatgaagctgagtatcaacgctcaattgaagatactaagggtttttgggat
gaaaaagcgagagagtttttaacttggtcaaagccatgggatgtaacagtagagcatgat
tttccaaaaggtgaggttaaatggtttactggaggcaagctcaatgtaagtgttaattgc
ttggatcggcatcttgaaacgcgtggcgatcagccagctattatttgggaaagtgatgat
ccggcagtcgataaaacatatacttataaagagcttcatgcggaggtgtgtcgctttgct
aatggtttaaaagccgagggtgtaaaaaaaggtgaccgtgtttgtatttatatgccaatg
gttgctgaagctgccattgcaatgcttgcgtgcgcaagaattggtgcggttcatctagtt
gtttttggtggtttttcccctgatgcgttaaaagataggcttcttgattcagaagcggcg
gtaattattgtcgccgatgaaagtgttcgtggaggtaaagcagtaccgttaaaggctaat
gcggatcaagccttaaaaagttgcccttcagtaaaatcagtggtggtggttcaacgtaca
ggtggcagtatagattggacagatggtcgagatgtttggtatcacgatttacttgagaat
gcgtcagatgattgcccagctgaagaaatggactctgaagatcccttgtttatcctttat
acatcgggctcaacaggcaaaccaaaaggtgttttacatacgacgggtggctatttgcta
catgctgcggtgtcgcacaaatatgtttttgactatcacgatggggatgtttactggtgt
acagcggatgtaggctgggtaacggggcatacatacattgtttatgggccattagcgaat
ggtgcgcaaacgttgatgtttgaaggcgtgccaacttatcctgatgcttcgcgcttttgg
aaagtggtggaaaagcataaagttaatattttttacacggcacctacggctattcgtgcc
ttgatggctaaaggtgatgattatgtaaagacttgcgacttaagtagtctaagagttctg
ggtagtgtgggtgagccgattaacccagaagcttgggagtggtatcacaaggtgattggc
ggtggtcgttgcccgattgtggatacttggtggcaaacagaaacgggcgggattttaatg
acaccccttccgggagcgactgacctgaaagccggttcggcgatgcagcctttctttggt
atagagtttggtttggtagataacgaaggtaatgaagtaacgggaaatcctgccgaaggg
attttagtgattaaaaaaccatggcctgggatgtttagaacattgtttggtgatcatcag
cgttatattgatgcttattttgcgaattatcctgggatgtattttcctggtgatggtgca
cgacgagataaagatggagattattggattaccggtagggttgatgatgtgattaatgtg
tctggtcacaggatgggtaccgcagaagttgagagcgccttagtgcttcatccagcagtg
gctgaggcggcggttattggttatcctcatgatataaaggggcaaggtatttatactttt
gtgaccttgatggatggggtcgaagcaacggatgaattacgtcaagagttagtgaaccat
gtgcgtaaagagatagggccaatagcctcgcctgatgttattcaatgggcgccaggctta
cctaaaacacgctcaggtaaaattatgcgtagaattttacgtaaaatttctgaaaacttg
attgatgaattaggcgatacatcgaccttggctgatccatcagtcgtcgatgaccttatc
gcgaatcgccctagtcaataa

DBGET integrated database retrieval system