KEGG   Cycloclasticus sp. P1: Q91_0565Help
Entry
Q91_0565          CDS       T02265                                 

Definition
(GenBank) Glutamate 5-kinase, bacterial form
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
cyq  Cycloclasticus sp. P1
Pathway
cyq00330  Arginine and proline metabolism
cyq00332  Carbapenem biosynthesis
cyq01100  Metabolic pathways
cyq01130  Biosynthesis of antibiotics
cyq01230  Biosynthesis of amino acids
Module
cyq_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cyq00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Q91_0565
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Q91_0565
Enzymes [BR:cyq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Q91_0565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AFT66603
UniProt: K0C236
Position
572702..573826
Genome map
AA seq 374 aa AA seqDB search
MKSRVDLKRAKCCVIKIGSAVLTNNGQGLNRSAINHWVAQISQLKARGIDVIIVSSGSVA
EGMVRLGWSARPHALQELQAAASVGQMGLIQAYEQSFQAEGYKTAQVLLTHDDLANRTRY
LNARATIKTLLDFSVVPIINENDVVANEELRVGDNDTLAAIIANLMSADLLMILTDQDGF
FDSDPRVNSAAALLNEVGVDEEFLDQAASGGSGTLGCGGMQTKLTAARIASRSGTATIIA
PGLRQNVILSIIDGRAIGTLLIPNEAPVSARKRWLTAHLDVKGRVVLDVGAAQAIKRSGV
SLLPIGVVAVNGEFARGELVVCVNESGEELARGLVNYSSTDIDKIKQNNSSEIERLLGYV
GESEVIHRDNLVLL
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcaagagtcgatttaaaacgggctaaatgctgcgttataaaaattggtagcgcc
gttttaacaaataatggtcaaggtttaaatcgttcggctattaatcattgggtcgcacaa
attagccaattaaaagcacgcggaattgatgtaattattgtttcatcaggttcagtggca
gaaggaatggtgagattaggttggtccgctcgcccgcatgcgcttcaggagcttcaagcg
gctgcttcagttggtcaaatggggcttattcaggcatatgaacaaagctttcaagcagaa
ggctataaaacggcgcaggttttgctaacacatgatgatctggcaaatagaacgcggtat
ttaaatgccagagcaaccattaagaccttgttagatttctcggtcgtaccaattattaat
gaaaatgatgtggttgcaaatgaggaattacgtgttggtgataacgatacgctggcggct
attattgctaatttaatgagtgcagatttgttgatgattctcacagaccaagatggtttt
ttcgatagcgatccaagagtcaattcggctgcagccttattaaatgaagtaggtgttgat
gaagagtttctagatcaagcggctagcggtggttctggaactttggggtgtggcggtatg
caaacaaagttaacagcagcgcgaatcgcatctcgttctggaacggcaactattattgct
ccagggttaaggcaaaatgttattttaagtattattgatggtcgggcgatagggaccttg
ctaatacctaatgaagcccctgtttcggcgcgtaaacggtggttaacagcacatttagat
gtcaaaggtcgggttgtgctagatgttggagctgcgcaagcaataaaaaggtctggggtg
agtttgctgccaattggagttgttgccgttaatggtgagtttgctaggggcgaattagtt
gtttgtgttaatgaaagtggtgaagaattggcccgtggcttagtgaattacagctcaact
gatatagataaaattaagcaaaacaatagttctgaaattgaacggctacttggttatgtt
ggtgagtcagaagttattcatcgcgataatttggtcttgctatag

DBGET integrated database retrieval system