KEGG   Cycloclasticus sp. P1: Q91_0655Help
Entry
Q91_0655          CDS       T02265                                 

Definition
Fatty acid desaturase subfamily
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cyq  Cycloclasticus sp. P1
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:cyq01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:cyq01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
679321..680253
Genome map
AA seq 310 aa AA seqDB search
MRLLNRLKPMLVWFDTQSGLESVATKDSNKLGWAQVTPFVFMHLMVFAVVWVGFSWVALW
GAIFLYLVRMFAITGFYHRYFSHKLFKTSRFIQFFFAFMGASAAQRGPLWWASHHRVHHQ
ASDKEGDPHSPRLQGFIWSHCLWFLAPKNLQTKTDKVKDFNKFPELRWLDRFDITAPLVL
IVALYCTGFLMEIYYPQLETTGAQMVIWGFFISTVALYHGTYTINSLAHCFGSRRFDTPD
DSRNNALLAIITLGEGWHNNHHFYPGSARQGFLWWEFDMTFYVLKVMSWCGLVWDLKPIP
LEVQKEIKRK
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttgctaaaccgcttaaaaccgatgcttgtatggttcgatacccaatccggtttg
gagtcagttgccactaaagactcgaataaattgggctgggctcaagtcaccccattcgtt
tttatgcatttaatggtattcgctgtcgtgtgggtcgggttcagttgggtagctctttgg
ggcgcaatctttctatatttagtcagaatgtttgcgattactggtttttaccaccgatat
ttttcacataaattgtttaaaacgtcacgttttatacaattcttttttgcatttatgggc
gccagtgcggcgcaacgaggcccattgtggtgggcctcacatcatagagttcaccatcag
gcttctgataaagaaggtgacccacactcaccccggttgcaaggcttcatttggagtcat
tgcctttggttcttagcacccaaaaacttgcaaacaaaaactgataaggtgaaagacttt
aataagttcccagaacttaggtggcttgatcgattcgatataacggcacctttggtgctg
atagtcgccctgtattgcaccggctttctgatggaaatctattaccctcagctagaaaca
acaggcgcgcaaatggttatatggggcttctttatatcaacagttgccttatatcacggc
acttacacgataaattcactggcacattgtttcggtagccgtcgtttcgatacacctgat
gacagccgtaataacgcactcttagcaattattacactcggcgaaggctggcataacaac
catcacttttacccgggaagtgcccgtcagggcttcctatggtgggaatttgatatgacg
ttctatgtgctaaaagtaatgagttggtgcggcttagtgtgggatttaaaacccattccg
cttgaggttcaaaaagaaattaaaaggaaatag

DBGET integrated database retrieval system