KEGG   Cycloclasticus sp. P1: Q91_0655Help
Entry
Q91_0655          CDS       T02265                                 

Definition
Fatty acid desaturase subfamily
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cyq  Cycloclasticus sp. P1
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cyq00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Q91_0655
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Q91_0655
Enzymes [BR:cyq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Q91_0655
Lipid biosynthesis proteins [BR:cyq01004]
 Desaturase
  First
   Q91_0655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
679321..680253
Genome map
AA seq 310 aa AA seqDB search
MRLLNRLKPMLVWFDTQSGLESVATKDSNKLGWAQVTPFVFMHLMVFAVVWVGFSWVALW
GAIFLYLVRMFAITGFYHRYFSHKLFKTSRFIQFFFAFMGASAAQRGPLWWASHHRVHHQ
ASDKEGDPHSPRLQGFIWSHCLWFLAPKNLQTKTDKVKDFNKFPELRWLDRFDITAPLVL
IVALYCTGFLMEIYYPQLETTGAQMVIWGFFISTVALYHGTYTINSLAHCFGSRRFDTPD
DSRNNALLAIITLGEGWHNNHHFYPGSARQGFLWWEFDMTFYVLKVMSWCGLVWDLKPIP
LEVQKEIKRK
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttgctaaaccgcttaaaaccgatgcttgtatggttcgatacccaatccggtttg
gagtcagttgccactaaagactcgaataaattgggctgggctcaagtcaccccattcgtt
tttatgcatttaatggtattcgctgtcgtgtgggtcgggttcagttgggtagctctttgg
ggcgcaatctttctatatttagtcagaatgtttgcgattactggtttttaccaccgatat
ttttcacataaattgtttaaaacgtcacgttttatacaattcttttttgcatttatgggc
gccagtgcggcgcaacgaggcccattgtggtgggcctcacatcatagagttcaccatcag
gcttctgataaagaaggtgacccacactcaccccggttgcaaggcttcatttggagtcat
tgcctttggttcttagcacccaaaaacttgcaaacaaaaactgataaggtgaaagacttt
aataagttcccagaacttaggtggcttgatcgattcgatataacggcacctttggtgctg
atagtcgccctgtattgcaccggctttctgatggaaatctattaccctcagctagaaaca
acaggcgcgcaaatggttatatggggcttctttatatcaacagttgccttatatcacggc
acttacacgataaattcactggcacattgtttcggtagccgtcgtttcgatacacctgat
gacagccgtaataacgcactcttagcaattattacactcggcgaaggctggcataacaac
catcacttttacccgggaagtgcccgtcagggcttcctatggtgggaatttgatatgacg
ttctatgtgctaaaagtaatgagttggtgcggcttagtgtgggatttaaaacccattccg
cttgaggttcaaaaagaaattaaaaggaaatag

DBGET integrated database retrieval system