KEGG   Cycloclasticus sp. P1: Q91_0726Help
Entry
Q91_0726          CDS       T02265                                 

Gene name
folE
Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cyq  Cycloclasticus sp. P1
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cyq00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
760133..760678
Genome map
AA seq 181 aa AA seqDB search
MEKLYKQIISQVGEDVNRQGLVDTPKRAAKAMSFLTSGYQQSLENIVNGAVFDSDADDMV
IVKNIELYSMCEHHLLPFIGKCHVAYLPDGKVLGLSKVARIVDMYARRLQIQEQLTTQIA
DSILEVTGAKGVAVVVEAKHLCMMMRGVEKQNSQMTTSSMLGQFRKNSETRAEFLSLLKM
G
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaactatataaacaaataatttcacaggttggagaagacgttaatcgccaaggt
ttggttgatacgccaaagcgtgcggcaaaagcaatgtctttcttaacaagcggctatcag
caaagtttagagaatattgtgaatggcgccgtttttgactctgatgctgatgatatggtg
attgttaaaaatatagaactgtattctatgtgtgagcaccatttactaccctttattggc
aagtgccatgtggcgtatctgccagatggaaaagtacttggtttatcaaaggtagctaga
atcgtcgatatgtatgcacgtcgattacaaattcaagagcaattgacgacacaaattgca
gattctattctcgaagtaacgggtgcaaaaggggttgcagtggttgtggaggcaaaacat
ttgtgcatgatgatgcgaggtgtggagaaacaaaactcacaaatgactacatcaagtatg
ttggggcaatttcgtaaaaattctgaaacacgggctgaatttttaagcttattaaaaatg
ggttag

DBGET integrated database retrieval system