KEGG   Cycloclasticus sp. P1: Q91_0726Help
Entry
Q91_0726          CDS       T02265                                 

Gene name
folE
Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cyq  Cycloclasticus sp. P1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Q91_0726 (folE)
Enzymes [BR:cyq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Q91_0726 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
760133..760678
Genome map
AA seq 181 aa AA seqDB search
MEKLYKQIISQVGEDVNRQGLVDTPKRAAKAMSFLTSGYQQSLENIVNGAVFDSDADDMV
IVKNIELYSMCEHHLLPFIGKCHVAYLPDGKVLGLSKVARIVDMYARRLQIQEQLTTQIA
DSILEVTGAKGVAVVVEAKHLCMMMRGVEKQNSQMTTSSMLGQFRKNSETRAEFLSLLKM
G
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaactatataaacaaataatttcacaggttggagaagacgttaatcgccaaggt
ttggttgatacgccaaagcgtgcggcaaaagcaatgtctttcttaacaagcggctatcag
caaagtttagagaatattgtgaatggcgccgtttttgactctgatgctgatgatatggtg
attgttaaaaatatagaactgtattctatgtgtgagcaccatttactaccctttattggc
aagtgccatgtggcgtatctgccagatggaaaagtacttggtttatcaaaggtagctaga
atcgtcgatatgtatgcacgtcgattacaaattcaagagcaattgacgacacaaattgca
gattctattctcgaagtaacgggtgcaaaaggggttgcagtggttgtggaggcaaaacat
ttgtgcatgatgatgcgaggtgtggagaaacaaaactcacaaatgactacatcaagtatg
ttggggcaatttcgtaaaaattctgaaacacgggctgaatttttaagcttattaaaaatg
ggttag

DBGET integrated database retrieval system