KEGG   Cycloclasticus sp. P1: Q91_0780Help
Entry
Q91_0780          CDS       T02265                                 

Gene name
bdhA
Definition
D-beta-hydroxybutyrate dehydrogenase protein
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
cyq  Cycloclasticus sp. P1
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyq00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Q91_0780 (bdhA)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Q91_0780 (bdhA)
Enzymes [BR:cyq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Q91_0780 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
812361..813143
Genome map
AA seq 260 aa AA seqDB search
MDLKGKAAIITGSTSGIGLGIAQGFAAQGINIMLNGFGDSVEIEKERQAIENQGVKCIYN
DADMTQPDEITAMVEEAVKVFGSIDIVVNNAGIQHVAPVEEFSPEKWDSIIAINMSSSFH
TVRAAIPHMKRQGWGRIINIASAHGLIASPFKSAYVTAKHGVLGFTKTIALEVAEDNITC
NAICPGYVLTPLVEKQIPDTAKARGISEEEVKRDVILSAQWTKKFVTVEELAGTSLFLCS
EHAENITGTHISVDGGWTAG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggatttgaaaggaaaagcagcgataataaccggttcaacatcgggaattggtttaggc
attgcgcaggggtttgcagcgcaaggcattaatattatgttgaatgggtttggtgattcg
gttgagattgaaaaagaacggcaggcgattgaaaaccaaggggttaagtgtatctataat
gatgctgatatgacccaaccggatgaaataacagccatggtcgaagaggctgtgaaggtt
tttggttctattgacattgttgttaataatgcgggaattcagcacgttgcacccgttgaa
gaattttcgcctgagaagtgggatagcattatagcgatcaatatgtcctcaagttttcat
accgtacgtgccgctattccgcatatgaaaagacaaggttgggggcgaattattaatata
gcatcggcacatggacttattgcatcgccttttaaatcggcatacgttaccgctaagcat
ggtgtgttggggtttacaaaaacaattgccttagaagtggcggaagacaatattacttgt
aatgctatttgcccgggctatgtattaactccgttagttgaaaaacaaattccggatacg
gctaaggctcgtggtattagtgaggaagaagtaaaacgagacgttattttatcggcgcaa
tggactaagaagtttgtgactgttgaggagttagcagggacgtctttatttttgtgttcg
gaacacgctgagaatattacaggtacacatatatccgtcgatggtggttggacggctggc
taa

DBGET integrated database retrieval system