KEGG   Cycloclasticus sp. P1: Q91_0832Help
Entry
Q91_0832          CDS       T02265                                 

Definition
glycoside hydrolase, family 3-like protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cyq  Cycloclasticus sp. P1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyq00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Q91_0832
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Q91_0832
Enzymes [BR:cyq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Q91_0832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
870849..871883
Genome map
AA seq 344 aa AA seqDB search
MKSPMPLGPLMIDIDSVELSAVDREVLKHPLVGGVILFSRNYDSIEQVSVLCDEIHRLRA
EPLLLAVDHEGGRVQRFKEGFTPIPCMQMLGECYQEDKENALNYARQVAWLMAMELRQVG
VDFSFAPVLDIDYACSDVIGDRAFSSDKKIVAEVAEAFQQGLAEAGMASIGKHFPGHGAV
APDSHVAIPIDERSLEDILQDDVYPFRQLIQAGMKGIMPAHVIYQQVDEMPAGFSEFWLQ
TILRQQLGFQGAIFSDDLTMQGASVVGDIGQRAQQALKAGGDMALICNDRTAAEQVIDHL
NGVEINTNSIERLKKMRPTTRLPEGHLQGSLKWQQCRKIIDGFN
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgcctatgccccttgggcctttaatgattgatattgacagtgtggaattatcg
gccgttgatcgagaggttcttaaacaccctctagtgggcggtgttatccttttttcaagg
aattatgacagtattgaacaagtctcagtgctttgtgatgaaattcatcgtttaagagca
gagccgttgttgctagctgttgatcacgaaggtgggcgagtgcagcgctttaaagagggg
tttacccccatcccttgtatgcaaatgttaggtgagtgctatcaggaagataaggaaaat
gctctcaattatgcgcggcaagtggcttggttaatggcaatggaattgaggcaggtggga
gttgattttagttttgcaccagtgctggatattgattacgcttgcagcgatgttataggc
gatcgtgcgttttcgagtgataaaaaaatcgttgctgaggtggctgaagcattccagcaa
gggctggctgaagcaggcatggcaagcatcggtaagcattttcctgggcatggtgcagta
gcacctgattctcatgttgcgattccaattgatgagcgttcattagaagacattttacaa
gatgatgtgtacccctttaggcagctcatacaagcaggaatgaaaggcattatgccggcg
catgttatttatcaacaggttgatgaaatgccagccggtttttctgagttttggttgcaa
actattttgcgtcagcaattaggctttcaaggtgctatattcagtgatgacctgaccatg
cagggtgctagtgtagttggtgatattgggcaacgagcgcagcaggcgttaaaggcgggt
ggcgatatggcacttatctgtaatgatcgaaccgcagccgaacaggttattgatcactta
aatggtgttgaaataaacactaactctatcgaaaggttaaaaaaaatgcgaccgacaaca
aggcttcctgaaggccatcttcaaggttctttaaagtggcaacaatgccgaaagatcatt
gatgggtttaactaa

DBGET integrated database retrieval system