KEGG   Cycloclasticus sp. P1: Q91_0856Help
Entry
Q91_0856          CDS       T02265                                 

Definition
disulfide bond isomerase, DsbC/G-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
cyq  Cycloclasticus sp. P1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
893001..893702
Genome map
AA seq 233 aa AA seqDB search
MNKVLLGWFLLACCSAPVLADEASVVTGLSKVIPNIMENHVSKTPIEGLYQVLIGARVVY
ASEDGRYILQGEMVDLVSRENMTDSALKTARQSEMAKIDEKKMIVFPAKNEKHVITIFSD
IDCGYCRKLHAEINDYTDAGMTVRYMFFPRSGPNTESYHKAVSVWCAKDRNKALTDAKLN
NKVVDKTCENPVDEHMRIAQVFGVTGTPAIIADDGTMVPGFVPANDLIQHLGW
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaataaggttttgcttggttggtttttattagcgtgttgtagtgcaccggttttggca
gatgaggcttctgttgtcacaggcttatctaaagtgataccaaatattatggagaaccat
gtttctaaaacacctatagagggtctgtatcaggtattgataggggctagggttgtttat
gcatctgaggatggacggtatattcttcaaggtgaaatggttgatttagtcagtcgtgaa
aatatgacagattctgcgttaaaaactgctcgtcaatcagagatggcaaagatagatgaa
aaaaagatgattgtttttccggctaaaaatgaaaaacatgttattaccattttttcagat
attgactgtggttattgccgaaaactacatgccgaaatcaacgattatacggatgctgga
atgaccgtacgctatatgtttttcccacgttcgggtccaaatacagagtcttaccataaa
gcggtgtcggtctggtgtgcaaaggatagaaataaagcgttaacagatgcaaaattaaac
aacaaagtggttgataaaacgtgtgaaaacccagttgatgagcacatgagaatcgcgcaa
gttttcggtgttactggtacaccggctatcattgctgatgatggcaccatggtgccaggc
tttgttccggctaacgatttgattcagcacttaggctggtaa

DBGET integrated database retrieval system