KEGG   Cycloclasticus sp. P1: Q91_1016Help
Entry
Q91_1016          CDS       T02265                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cyq  Cycloclasticus sp. P1
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:cyq00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1079186..1080364
Genome map
AA seq 392 aa AA seqDB search
MKNVCLLGSTGSIGVSTLDVIRLNKNAYRVVALTANKNIGRLLEQCIEFKPTYAVVPDAE
LAEAFRGKLERSDACETQVLSGMDSLEFVAKHSMTDIVVAAIVGAVGLLSTLAGAKAGKT
ILLANKESLVVSGDLLMSVVKQNGATLLPLDSEHNALFQCMPDAYKAGQRAEGVRKLILT
ASGGPFLNLNASELDNVTVEQACAHPNWSMGHKISVDSATMMNKGLELIEASYLFDMPAE
LIDVLIHPQSIVHSMIDYVDGSVLAQLGNPDMRTPIAHALAWPKRHESGVSALDFLVNNQ
LTFESASYEKFPCLRLAYEALDAKGTAPAILNAANEVAVEAFLAKELAFTGISTLIEQVL
SITTVSPADSIESVLSADAQARQVAKNCLENG
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgtttgcttgcttggctcaactggctcaattggagttagtacgcttgatgtt
ataagactcaataagaatgcttacagagtagttgcactgacagctaataaaaacattggg
cggttattagagcaatgtatagaatttaagccaacttatgcagtggttccagatgctgag
cttgcagaggcgtttagagggaagttggaacgctctgacgcatgtgaaacccaagtgtta
tctggcatggattctttagagtttgttgctaaacattcaatgactgatattgtggtggca
gccattgttggagcggttggtttattgtcaactttagcgggtgctaaggcaggtaaaaca
attttactggcgaataaagaatctttagttgtatcgggtgatttattgatgtctgtagtg
aaacaaaatggtgccacattgctaccgttagacagcgaacataatgctttatttcaatgt
atgcccgatgcatacaaggctgggcaacgtgctgagggtgttagaaaattaattttaacg
gcttctggtgggccttttttgaatcttaatgccagtgagttggataatgtaacggtcgag
caggcttgtgcacacccaaactggtcaatggggcataaaatctctgttgactcagcgact
atgatgaataaaggtttggagttaattgaagcgagttatttatttgatatgcccgctgaa
ttaatagatgtgctgatacatcctcaaagtattgttcattcgatgattgattatgtggat
gggtctgttttagcgcaacttggaaaccccgatatgcgcacacccatagcacatgcatta
gcatggccaaaaaggcatgagagtggcgtgtcagcgctggattttctagtgaataatcaa
ttaacatttgaatcagcctcatatgaaaaattcccttgcttacgtttagcttatgaagct
ttagatgctaaaggaacagcaccagcgatcttaaatgcagcaaatgaagtcgccgttgaa
gcatttttggcaaaagaattagcgttcactggtatttccacattgattgagcaggtgttg
agtattacaacagtgagccctgctgactcaattgaaagcgttttaagcgcagatgcacaa
gcacgtcaggttgcaaaaaattgtttggagaacggttaa

DBGET integrated database retrieval system