KEGG   Cycloclasticus sp. P1: Q91_1038Help
Entry
Q91_1038          CDS       T02265                                 

Definition
L-isoaspartate protein carboxylmethyltransferase type II
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cyq  Cycloclasticus sp. P1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1103197..1103853
Genome map
AA seq 218 aa AA seqDB search
MKDLTGIGMTSQRTRDRLIAHLKELGIKDERVLSVMRKVPRHLFMAEALSSRAYENTSLP
IGHGQTISQPYMVARMTELLIEDGLPENVLEVGTGSGYQSAILASLIPRVFSVERIRPLQ
EQAKRVLADIGVRNISFKHSDGGWGWKACGPYQAILAAAAPAEIPMNLLEQLTIGARLII
PVGKEGQQVLQRVTRTESAYEVETIEEVSFVPFLKGRA
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacctaacaggcattgggatgacttcgcagcgcacccgagacaggcttattgct
catttaaaagaactaggtattaaggatgagcgggtgttatcggtaatgagaaaagtaccg
cggcacttatttatggctgaagccttatcaagtcgggcttatgagaatacctcgctacca
attgggcatggtcaaaccatttcgcaaccgtatatggttgcgcgcatgactgaactattg
attgaagatggtttgcctgaaaatgtcttagaagttggaactggttcgggctatcaatct
gctattttggccagtttaatacccagagtattttcagttgaaagaatcaggccgttgcaa
gaacaagcaaagagagtgttggctgatataggggttagaaatataagtttcaaacattca
gatggcggttgggggtggaaggcatgtgggccttatcaggctattttggcggccgccgca
cctgctgagattcctatgaatttattagagcaactaaccattggtgctaggctgattatt
cccgttggcaaagaagggcaacaagttttacagcgagtgaccagaacagaatcggcttat
gaagttgaaacgattgaagaagttagtttcgtaccttttttaaaagggcgtgcctag

DBGET integrated database retrieval system