KEGG   Cycloclasticus sp. P1: Q91_1044Help
Entry
Q91_1044          CDS       T02265                                 

Definition
Threonine synthase, pyridoxal-5'-phosphate-dependent enzyme
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cyq  Cycloclasticus sp. P1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cyq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Q91_1044
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Q91_1044
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Q91_1044
Enzymes [BR:cyq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Q91_1044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1108798..1109940
Genome map
AA seq 380 aa AA seqDB search
MPTGNRYIGLIDKFKTVLPVSDSTRLISLGEGNTPLIQLQNIPALIGKNVDIYVKYEGLN
PTGSFKDRGMTMAVTKAVEEGSKAIICASTGNTSASAAAYAARAGIKAFVLIPEGKIALG
KLAQAMIHGAEIIQIKGNFDHGMQLVKEVAEHAPVTIVNSINPYRLQGQKTASYEIVEAL
GKAPDYHCLPVGNAGNITAHWIGYSEMAQPAGEHVTDSCAFCEGDCEYDRTQYVTAKRPV
MVGYQAAGAAPFLKGEMIDEPETVATAIRIGRPQSWDQAWAAQKESGGWFDLLTDEEILA
TQKLLTEKEGIFCEPASAASVGGAIRDIKNGKIPEGSTVVCTLTGHGLKDPDTAIAQCAV
NPNAIEASLDAVKAAILDKL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgccaacaggaaatcgttatatcggtctaatcgacaaatttaaaactgtgttgccagtg
tctgacagcactcgcttgattagtttaggtgaagggaatacgccgcttattcaattgcag
aatattcccgcgttgattggtaaaaatgtcgatatttatgttaagtatgaaggcttgaac
ccaacaggttcttttaaagaccgtggcatgacgatggcggtaacaaaagcagtcgaagag
ggtagtaaggctattatttgtgcatctacaggcaatacctcggcatcagctgcggcctat
gctgctcgtgcaggtattaaagcttttgtattaattcctgaaggaaaaattgcgttaggt
aaattggcacaagcaatgattcacggcgcagaaataatacaaattaaaggtaactttgat
catgggatgcaattggttaaagaggttgcagagcacgcgcctgtaaccattgttaactct
attaacccttatcgtttgcaaggccaaaaaacagcctcctacgaaattgttgaggcctta
ggtaaagcgccagattatcattgtttacccgtcggtaacgctggaaacattacagctcac
tggattgggtatagtgaaatggcacaaccagccggtgagcacgtaaccgattcatgtgca
ttttgtgagggtgattgcgaatatgatcgtacacaatatgtaaccgctaagcgccctgtg
atggtgggctatcaagcagctggcgcagctcctttcttaaaaggtgaaatgattgatgaa
ccagaaacagtagcaacagcaattcgtattgggcgaccacaatcttgggatcaagcgtgg
gcggcacaaaaggaatcaggtggttggtttgacttgctgactgatgaagaaattcttgca
acacaaaagttactcactgaaaaagaagggattttctgtgaacccgcgtctgctgcttct
gttggtggtgctattcgtgatataaaaaacggcaaaatccctgagggcagtacggttgtt
tgtacattaactggacatgggctgaaagaccccgatacggccattgcgcagtgtgcggta
aatcctaacgccattgaggcgtcattggatgctgttaaagcggctattttagacaagtta
taa

DBGET integrated database retrieval system