KEGG   Cycloclasticus sp. P1: Q91_1044Help
Entry
Q91_1044          CDS       T02265                                 

Definition
(RefSeq) Threonine synthase, pyridoxal-5'-phosphate-dependent enzyme
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cyq  Cycloclasticus sp. P1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cyq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Q91_1044
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Q91_1044
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Q91_1044
Enzymes [BR:cyq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Q91_1044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1108798..1109940
Genome map
AA seq 380 aa AA seqDB search
MPTGNRYIGLIDKFKTVLPVSDSTRLISLGEGNTPLIQLQNIPALIGKNVDIYVKYEGLN
PTGSFKDRGMTMAVTKAVEEGSKAIICASTGNTSASAAAYAARAGIKAFVLIPEGKIALG
KLAQAMIHGAEIIQIKGNFDHGMQLVKEVAEHAPVTIVNSINPYRLQGQKTASYEIVEAL
GKAPDYHCLPVGNAGNITAHWIGYSEMAQPAGEHVTDSCAFCEGDCEYDRTQYVTAKRPV
MVGYQAAGAAPFLKGEMIDEPETVATAIRIGRPQSWDQAWAAQKESGGWFDLLTDEEILA
TQKLLTEKEGIFCEPASAASVGGAIRDIKNGKIPEGSTVVCTLTGHGLKDPDTAIAQCAV
NPNAIEASLDAVKAAILDKL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgccaacaggaaatcgttatatcggtctaatcgacaaatttaaaactgtgttgccagtg
tctgacagcactcgcttgattagtttaggtgaagggaatacgccgcttattcaattgcag
aatattcccgcgttgattggtaaaaatgtcgatatttatgttaagtatgaaggcttgaac
ccaacaggttcttttaaagaccgtggcatgacgatggcggtaacaaaagcagtcgaagag
ggtagtaaggctattatttgtgcatctacaggcaatacctcggcatcagctgcggcctat
gctgctcgtgcaggtattaaagcttttgtattaattcctgaaggaaaaattgcgttaggt
aaattggcacaagcaatgattcacggcgcagaaataatacaaattaaaggtaactttgat
catgggatgcaattggttaaagaggttgcagagcacgcgcctgtaaccattgttaactct
attaacccttatcgtttgcaaggccaaaaaacagcctcctacgaaattgttgaggcctta
ggtaaagcgccagattatcattgtttacccgtcggtaacgctggaaacattacagctcac
tggattgggtatagtgaaatggcacaaccagccggtgagcacgtaaccgattcatgtgca
ttttgtgagggtgattgcgaatatgatcgtacacaatatgtaaccgctaagcgccctgtg
atggtgggctatcaagcagctggcgcagctcctttcttaaaaggtgaaatgattgatgaa
ccagaaacagtagcaacagcaattcgtattgggcgaccacaatcttgggatcaagcgtgg
gcggcacaaaaggaatcaggtggttggtttgacttgctgactgatgaagaaattcttgca
acacaaaagttactcactgaaaaagaagggattttctgtgaacccgcgtctgctgcttct
gttggtggtgctattcgtgatataaaaaacggcaaaatccctgagggcagtacggttgtt
tgtacattaactggacatgggctgaaagaccccgatacggccattgcgcagtgtgcggta
aatcctaacgccattgaggcgtcattggatgctgttaaagcggctattttagacaagtta
taa

DBGET integrated database retrieval system