KEGG   Cycloclasticus sp. P1: Q91_1044Help
Entry
Q91_1044          CDS       T02265                                 

Definition
Threonine synthase, pyridoxal-5'-phosphate-dependent enzyme
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cyq  Cycloclasticus sp. P1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cyq01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cyq00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:cyq00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1108798..1109940
Genome map
AA seq 380 aa AA seqDB search
MPTGNRYIGLIDKFKTVLPVSDSTRLISLGEGNTPLIQLQNIPALIGKNVDIYVKYEGLN
PTGSFKDRGMTMAVTKAVEEGSKAIICASTGNTSASAAAYAARAGIKAFVLIPEGKIALG
KLAQAMIHGAEIIQIKGNFDHGMQLVKEVAEHAPVTIVNSINPYRLQGQKTASYEIVEAL
GKAPDYHCLPVGNAGNITAHWIGYSEMAQPAGEHVTDSCAFCEGDCEYDRTQYVTAKRPV
MVGYQAAGAAPFLKGEMIDEPETVATAIRIGRPQSWDQAWAAQKESGGWFDLLTDEEILA
TQKLLTEKEGIFCEPASAASVGGAIRDIKNGKIPEGSTVVCTLTGHGLKDPDTAIAQCAV
NPNAIEASLDAVKAAILDKL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgccaacaggaaatcgttatatcggtctaatcgacaaatttaaaactgtgttgccagtg
tctgacagcactcgcttgattagtttaggtgaagggaatacgccgcttattcaattgcag
aatattcccgcgttgattggtaaaaatgtcgatatttatgttaagtatgaaggcttgaac
ccaacaggttcttttaaagaccgtggcatgacgatggcggtaacaaaagcagtcgaagag
ggtagtaaggctattatttgtgcatctacaggcaatacctcggcatcagctgcggcctat
gctgctcgtgcaggtattaaagcttttgtattaattcctgaaggaaaaattgcgttaggt
aaattggcacaagcaatgattcacggcgcagaaataatacaaattaaaggtaactttgat
catgggatgcaattggttaaagaggttgcagagcacgcgcctgtaaccattgttaactct
attaacccttatcgtttgcaaggccaaaaaacagcctcctacgaaattgttgaggcctta
ggtaaagcgccagattatcattgtttacccgtcggtaacgctggaaacattacagctcac
tggattgggtatagtgaaatggcacaaccagccggtgagcacgtaaccgattcatgtgca
ttttgtgagggtgattgcgaatatgatcgtacacaatatgtaaccgctaagcgccctgtg
atggtgggctatcaagcagctggcgcagctcctttcttaaaaggtgaaatgattgatgaa
ccagaaacagtagcaacagcaattcgtattgggcgaccacaatcttgggatcaagcgtgg
gcggcacaaaaggaatcaggtggttggtttgacttgctgactgatgaagaaattcttgca
acacaaaagttactcactgaaaaagaagggattttctgtgaacccgcgtctgctgcttct
gttggtggtgctattcgtgatataaaaaacggcaaaatccctgagggcagtacggttgtt
tgtacattaactggacatgggctgaaagaccccgatacggccattgcgcagtgtgcggta
aatcctaacgccattgaggcgtcattggatgctgttaaagcggctattttagacaagtta
taa

DBGET integrated database retrieval system