KEGG   Cycloclasticus sp. P1: Q91_1063Help
Entry
Q91_1063          CDS       T02265                                 

Definition
(GenBank) Succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
cyq  Cycloclasticus sp. P1
Pathway
cyq00020  Citrate cycle (TCA cycle)
cyq00190  Oxidative phosphorylation
cyq00650  Butanoate metabolism
cyq01100  Metabolic pathways
cyq01110  Biosynthesis of secondary metabolites
cyq01120  Microbial metabolism in diverse environments
cyq01130  Biosynthesis of antibiotics
cyq01200  Carbon metabolism
Module
cyq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cyq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cyq_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cyq00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Q91_1063
   00650 Butanoate metabolism
    Q91_1063
  Energy metabolism
   00190 Oxidative phosphorylation
    Q91_1063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AFT67101
UniProt: K0C5U3
Position
1125529..1125909
Genome map
AA seq 126 aa AA seqDB search
MSLRSPLGQAKGLGSAKDGLHHWWAQRVTAVALIPLTIWFAFKVAVLSMADYTTVVDCIG
TPWSAALIVSLVVAAFYHAALGMQVIYEDYIGAKAVRIAAIMGTNLLLFLLAAASIIAVV
RIAVGG
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagtttaagatcaccacttggccaggctaaaggcctaggttcagcaaaagacggttta
caccactggtgggctcaacgtgtaacggccgttgcccttattccattaacaatttggttt
gcgtttaaagtggctgtactcagcatggctgattacacaaccgttgtagactgtattggc
acgccttggtctgctgctttgattgttagtttagttgttgctgctttctatcatgccgca
ttgggtatgcaagttatttacgaggactatattggtgctaaggctgtacgaattgccgcc
attatggggactaacttattattatttttattggccgctgcaagcattattgctgtggta
cgcattgctgtgggaggctag

DBGET integrated database retrieval system