KEGG   Cycloclasticus sp. P1: Q91_1063Help
Entry
Q91_1063          CDS       T02265                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
cyq  Cycloclasticus sp. P1
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:cyq01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cyq00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:cyq00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:cyq00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1125529..1125909
Genome map
AA seq 126 aa AA seqDB search
MSLRSPLGQAKGLGSAKDGLHHWWAQRVTAVALIPLTIWFAFKVAVLSMADYTTVVDCIG
TPWSAALIVSLVVAAFYHAALGMQVIYEDYIGAKAVRIAAIMGTNLLLFLLAAASIIAVV
RIAVGG
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagtttaagatcaccacttggccaggctaaaggcctaggttcagcaaaagacggttta
caccactggtgggctcaacgtgtaacggccgttgcccttattccattaacaatttggttt
gcgtttaaagtggctgtactcagcatggctgattacacaaccgttgtagactgtattggc
acgccttggtctgctgctttgattgttagtttagttgttgctgctttctatcatgccgca
ttgggtatgcaagttatttacgaggactatattggtgctaaggctgtacgaattgccgcc
attatggggactaacttattattatttttattggccgctgcaagcattattgctgtggta
cgcattgctgtgggaggctag

DBGET integrated database retrieval system