KEGG   Cycloclasticus sp. P1: Q91_1082Help
Entry
Q91_1082          CDS       T02265                                 

Definition
(GenBank) Tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cyq  Cycloclasticus sp. P1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cyq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Q91_1082
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Q91_1082
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Q91_1082
Enzymes [BR:cyq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Q91_1082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1141650..1142861
Genome map
AA seq 403 aa AA seqDB search
MQAAVTHYDLPDERGHFGPYGGLFVGETLMESIEELNEAYAKFMQDPDFLAELDADLHDY
VGRPSPIYHAKRLSEENGGAQIYLKREDLNHTGAHKINNTIGQALLAKRMGKTRIIAETG
AGQHGVATATVAARLGLECVVYMGAEDIQRQSPNVYRMKLLGAKVVPVTSGSQTLKDALN
EALRDWVTNIDDTYYIIGTVAGPHPYPAMVRDFQTVIGRESREQMIAKTGHLPNALVACV
GGGSNAIGLFHPFIKDQSVSIYGVEAAGLGVETGQHSAPLCAGKPGVLHGNRTYLMADDN
GEIIETHSISAGLDYPGVGPEHSWLKDIGRAEYVSIKDDEALAAFHQLTRVEGIIPALES
SHAVAYATKLAKKMNKDETILVCLSGRGDKDIFTIAKLEGIEL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcagctgtaacacattatgacttacctgatgaacgtggtcactttggcccttac
ggggggctgtttgttggtgaaacactaatggaatcgattgaagagttgaatgaggcatat
gctaaatttatgcaagaccccgattttcttgcagaattggatgctgatttgcatgactat
gtcggccgtccatctcctatctatcatgcaaaacgcttaagtgaagaaaatggtggtgcg
caaatttatcttaaacgagaagatttaaaccacaccggcgcgcataaaataaacaataca
attggccaagcgttattagctaaacgcatgggtaaaacacgaataattgcagaaactggt
gctggtcaacatggtgttgcgacggcaactgtagctgcacggctaggccttgagtgtgtt
gtttacatgggcgctgaagacattcagcgtcaatcacctaatgtatatcgtatgaaattg
ctaggtgccaaagtggtgccagttacttctggatcacaaacgcttaaagatgctctaaac
gaagcgcttagggactgggtaaccaatatagatgatacgtattatattatcggcacagta
gccgggccgcacccttatcctgcaatggtcagagactttcaaacggttattgggcgtgaa
tctcgtgagcaaatgattgctaaaacgggccacttacccaatgcgctagtggcctgtgtt
ggtggtggttctaatgccatcgggctttttcacccatttataaaagatcaatcagtctct
atttatggcgtagaagcggctggtttaggtgttgaaacagggcagcactcagcgccttta
tgtgcaggtaaaccaggtgtgctgcatgggaacagaacgtatttgatggccgatgacaac
ggtgaaattattgaaacgcattctatttctgctggtcttgattaccctggagtagggcca
gagcattcctggttaaaggatatagggcgtgccgaatatgtcagtattaaagatgatgag
gcgttagcggcttttcatcaattaacccgagtagaaggtattattcctgcgctggaatct
agccatgcagttgcttatgcgaccaaactagcgaaaaaaatgaacaaagatgaaaccatt
ttagtgtgcctatcgggtcgaggagacaaagatatatttactattgcgaaacttgaaggt
attgaactatga

DBGET integrated database retrieval system