KEGG   Cycloclasticus sp. P1: Q91_1166Help
Entry
Q91_1166          CDS       T02265                                 

Gene name
icl
Definition
(GenBank) Isocitrate lyase family protein
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
cyq  Cycloclasticus sp. P1
Pathway
cyq00630  Glyoxylate and dicarboxylate metabolism
cyq01100  Metabolic pathways
cyq01110  Biosynthesis of secondary metabolites
cyq01120  Microbial metabolism in diverse environments
cyq01200  Carbon metabolism
Module
cyq_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cyq00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Q91_1166 (icl)
Enzymes [BR:cyq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Q91_1166 (icl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AFT67203
UniProt: K0C3W6
Position
complement(1238324..1239922)
Genome map
AA seq 532 aa AA seqDB search
MSSYTNDINAVSELVQAKGDSWAAINPESVARMRAQNKFKTGLDIAQYTADIMNADMAAF
DADNTLYTQSLGCWHGFIGQQKMISIKKHFGGKTDRRYLYLSGWMVAALRSEFGPLPDQS
MHEKTAVASLVEELYTFLRQADARELGGLFRQLDTAREAGDEATVEQIQEEIDNHVTHVV
PIVADIDAGFGNAEATYLMAKQMIEAGACCLQIENQVADEKQCGHQDGKVTVPHADFHAK
IRALRHAFLELGIDNGLIVARTDSEGAGLTKEIAVVKEPGDQGDQYNSFLDVEEIDVADM
AEGDVCFNRDGKLVRPKRLPSGLYQFRQGTGPERCVFDSIEAIKAGADLLWIETATPSVK
DIADMMNEVRKEIPNAKLVYNNSPSFNWTLNFRQQAYDRWVEEGKDVSAYDREDLMNAKY
DATELAADADDKIRTFQADSSREANIFHHLITLPTYHTAALSTDNLAKEYFGEAGMLGYV
RDVQRKEIRQGIACVKHQNMSGSDMGDDHKEYFAGENALKAGGAKNTSNQFS
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcttatacaaatgatataaatgctgtttcagagttagtccaagctaagggagat
tcttgggctgccattaacccagaatctgttgcacgtatgcgtgcacagaacaaatttaaa
acgggccttgatatcgcgcaatataccgctgatattatgaatgcagacatggcggccttc
gatgcagacaacacgctatacacacaatcattaggttgctggcacggttttattggtcaa
caaaaaatgatttctattaagaagcactttggtggcaagacggatcgccgttacctttac
ctttctggttggatggtggcggccttacgctctgagtttggtcctttacccgatcaatca
atgcatgaaaaaaccgcggttgcttcattagtcgaagagctttatacatttcttcggcag
gctgacgcgcgtgaattaggaggcctgtttcgtcaattagatacggctcgcgaagcaggt
gatgaggctacagtcgaacaaatccaagaagaaattgataatcatgtgacccacgttgtg
ccgattgttgctgatattgatgcgggctttggtaatgcggaagcgacttatttaatggcc
aaacaaatgattgaagcgggggcctgttgtttacaaattgaaaaccaggtggcggatgaa
aaacaatgtggtcaccaagatggcaaagtcacggttcctcatgctgattttcatgccaaa
attcgtgcattacgtcacgcatttctagaattgggtatcgacaatgggctaattgttgct
cgtacagattctgaaggtgctggcctaaccaaagaaatcgcggtggttaaagagcctggt
gaccaaggcgatcaatacaattctttcttagatgttgaagaaattgacgtagctgatatg
gctgaaggtgacgtatgttttaatcgtgacggtaaacttgttcgccctaagcgcttacct
tctggtctataccaatttcgtcaaggtactggtcctgaacgttgcgtatttgactcaatc
gaagccattaaagcgggtgccgatcttctttggattgaaacggcaacaccaagcgttaaa
gacattgcagacatgatgaacgaagtacgtaaagagattcctaatgcgaagttagtgtac
aacaatagcccatcattcaactggacgcttaatttccgtcaacaggcttacgatcgatgg
gtcgaagagggtaaggatgtatcggcttacgaccgagaagatctgatgaatgctaaatat
gatgcaacggaattggctgccgatgcagacgataaaattcgcacgttccaagctgactcg
tctcgagaagcaaatatctttcatcacttgattacattgccgacgtaccacacagccgca
ttgtctacagataacttggctaaagagtatttcggtgaggctggaatgctaggctatgta
agggacgtacagcgaaaagaaattcgtcagggtattgcctgtgttaaacatcaaaatatg
tcgggatcagacatgggcgatgaccacaaagaatattttgcaggtgaaaatgcactgaaa
gcgggtggcgcgaaaaacacctccaatcagttttcttaa

DBGET integrated database retrieval system