KEGG   Cycloclasticus sp. P1: Q91_1167Help
Entry
Q91_1167          CDS       T02265                                 

Gene name
aceB
Definition
(RefSeq) malate synthase A
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
cyq  Cycloclasticus sp. P1
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cyq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Q91_1167 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Q91_1167 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    Q91_1167 (aceB)
Enzymes [BR:cyq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Q91_1167 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1240023..1241606)
Genome map
AA seq 527 aa AA seqDB search
MNALTFKGELLPSYASIYNDEANAFVSTLAEEFSPRVAALLEARKVRQAEIDAGQLPDFL
AETKHIREGDWRILGIPDDLQDRRVEITGPVDRKMIINALNANVKVFMADFEDSLSPTWD
KVAQGQVNMRDAVNGTISLDDPKSGKHYELNDDPAVLVCRARGLHLPEKHIHLNGQEIPG
GLIDFAYYFFHNYKTLLAKGSGPYFYIPKLQSHKEARWWADLMDKAEDLVGLERGTIKAT
VLIETLPAVFEMDEILYEFRDHIVALNCGRWDYIFSYIKTLKNYPDRVLPDRQVVTMDKP
FLSAYSRLLIKTCHKRGALAMGGMAAFIPAKDAEANATVLKKVVGDKTLEAKNGHDGTWV
AHPGLADTAMAVFNEYIGEGKANQMDVLRTEDADVTAEDLLEPCEGDRTEEGMRANLRIA
VQYIEAWIQGNGCVPIYGLMEDAATAEISRSSIWQWIHHGKNLSNGKKVTVELFRELMLE
EMETIKSEIGEKRFKEGRFSEAAKIMDRFTTSEKLVDFLTVPAYEYL
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcattaacgtttaaaggtgaactgttaccaagttatgccagtatttataacgat
gaagcaaatgcttttgtgtcaacattagcggaagagttttcccctcgtgttgcagcgtta
ctcgaggcacgtaaagtaaggcaggccgaaattgatgcgggtcaattgcctgacttttta
gcggaaacaaaacatatacgtgagggtgattggcgtatcttaggtattccagatgaccta
caagacagacgagtagagattaccggtcctgttgatcgtaaaatgatcattaatgcttta
aacgccaatgtaaaagtgtttatggccgattttgaggattcattgtcgccgacgtgggat
aaagtcgctcagggccaagttaatatgcgtgatgcagttaatgggactatctcattagat
gaccctaaatcaggcaaacactatgaactaaatgatgaccctgcggtacttgtttgccgc
gcacgaggtttgcatcttcctgaaaagcacattcatttaaacggacaggaaattcctggt
ggtttaattgattttgcatactattttttccataactataaaaccttattagcaaaaggt
tcagggccatacttttatattcctaaattgcaatcgcataaagaagctcgctggtgggct
gacttaatggataaagctgaagatttggtagggttagagcggggtactatcaaagcaact
gttttgattgaaacactaccagctgtcttcgaaatggatgagattctctacgaatttcgt
gatcatattgtggcacttaactgtggtcgttgggattatatatttagctacatcaaaacg
cttaaaaattacccagatcgtgtgcttccagaccgccaagttgtgaccatggataaaccc
tttttgagtgcatattcgaggctattaattaaaacttgtcataaacgcggtgctttagca
atgggcggaatggcagcgtttatacccgcaaaagatgccgaggctaatgccactgtctta
aaaaaagtcgttggcgataaaacgctagaagcaaaaaatggccatgatggaacatgggtc
gcgcacccaggtctggcagatacagcaatggcggtctttaatgaatatattggtgaaggc
aaagcaaaccaaatggacgtattgcgtactgaagatgccgacgtgacagcagaggattta
ttagagccttgtgaaggcgatcgaacagaagaggggatgcgggctaatttgcgaatagct
gttcaatatattgaagcatggatccaaggtaatggttgtgtgccgatctatggtttgatg
gaagatgcggcaactgctgagatttcacgctcatcaatctggcaatggatacatcacggc
aaaaacttaagcaacggcaaaaaagtaaccgttgaattgttccgcgaattaatgcttgaa
gaaatggaaactattaagagtgagattggtgaaaagcgctttaaagagggccgtttcagc
gaggcggcaaaaataatggaccgctttaccacatctgaaaaactagtggatttcttaacg
gtaccagcttacgagtatttgtag

DBGET integrated database retrieval system