KEGG   Cycloclasticus sp. P1: Q91_1378Help
Entry
Q91_1378          CDS       T02265                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
cyq  Cycloclasticus sp. P1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1454246..1455265
Genome map
AA seq 339 aa AA seqDB search
MLQQDEPKQAAEYLRQAIPMLSQHNLPPTPINYSIFYSYLSGNSQTLNDVIDSIISEKKP
FTLAIMLELYEKYINGGATLEQQEKIQHSLEKVMSSASEEVQQVSSGAGEFDSAINKHAE
TLSYTTDPQAAALVLKQVMQDTREMVKNNQATQARMQETNAEILKMKAELEAVKASAEKD
ALTGLKNRGAFDKAIDNVVHSETNLSATLVLLDIDHFKRVNDNFGHLVGDRVIRYVSALL
TQIVGSEHHIARYGGEEFAVILTGLDIDNAKQLTEKIRIAMSNSKLQRKESGEAIGEVTI
SAGIATVKATDSVELLIDRADKALYQAKEAGRNKVVIAA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgttacagcaagacgaacccaaacaagccgccgaatatttaaggcaagcaatcccaatg
ttgtcacaacataacttacctcccacccccatcaactactctattttttacagttattta
tctggtaattcccagacccttaatgacgtcatcgatagcattattagtgaaaaaaaacct
tttacattagctatcatgctggaactttatgaaaaatacatcaatggtggagcaacccta
gaacaacaagaaaaaatacagcactccttagaaaaagtcatgtcttcagcatctgaagaa
gtccaacaggtcagcagtggtgccggagagtttgacagcgcaattaacaaacatgctgaa
actttatcctatacaaccgacccacaggccgctgcacttgtgctcaaacaagtcatgcag
gatacacgagagatggttaagaacaatcaggccacccaagcaaggatgcaagaaacaaat
gctgaaattcttaaaatgaaagccgaattagaggcagtaaaagcaagcgctgaaaaagat
gcgttaacaggccttaaaaacagaggcgcgtttgataaagcgatagataacgttgttcat
agtgaaaccaatttaagtgcaaccctggttctacttgatattgatcactttaagcgtgta
aacgataattttggccaccttgtcggcgatcgagttattcgttacgtttccgcactttta
acccagattgttggctcagagcaccatattgctaggtatggtggtgaagaatttgcagtt
attttaaccggcctagatattgacaacgcgaagcagctgacggaaaaaatacgtattgca
atgagcaacagtaagctgcaacgaaaagaaagcggtgaagccattggagaggtaacaatc
tccgcaggtatcgcaacagttaaagcaaccgatagtgttgaactgttaattgatcgcgcc
gataaagcactgtaccaagcaaaagaagcaggccgaaataaggttgttatagccgcataa

DBGET integrated database retrieval system