KEGG   Cycloclasticus sp. P1: Q91_1378Help
Entry
Q91_1378          CDS       T02265                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
cyq  Cycloclasticus sp. P1
Brite
Enzymes [BR:cyq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Q91_1378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1454246..1455265
Genome map
AA seq 339 aa AA seqDB search
MLQQDEPKQAAEYLRQAIPMLSQHNLPPTPINYSIFYSYLSGNSQTLNDVIDSIISEKKP
FTLAIMLELYEKYINGGATLEQQEKIQHSLEKVMSSASEEVQQVSSGAGEFDSAINKHAE
TLSYTTDPQAAALVLKQVMQDTREMVKNNQATQARMQETNAEILKMKAELEAVKASAEKD
ALTGLKNRGAFDKAIDNVVHSETNLSATLVLLDIDHFKRVNDNFGHLVGDRVIRYVSALL
TQIVGSEHHIARYGGEEFAVILTGLDIDNAKQLTEKIRIAMSNSKLQRKESGEAIGEVTI
SAGIATVKATDSVELLIDRADKALYQAKEAGRNKVVIAA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgttacagcaagacgaacccaaacaagccgccgaatatttaaggcaagcaatcccaatg
ttgtcacaacataacttacctcccacccccatcaactactctattttttacagttattta
tctggtaattcccagacccttaatgacgtcatcgatagcattattagtgaaaaaaaacct
tttacattagctatcatgctggaactttatgaaaaatacatcaatggtggagcaacccta
gaacaacaagaaaaaatacagcactccttagaaaaagtcatgtcttcagcatctgaagaa
gtccaacaggtcagcagtggtgccggagagtttgacagcgcaattaacaaacatgctgaa
actttatcctatacaaccgacccacaggccgctgcacttgtgctcaaacaagtcatgcag
gatacacgagagatggttaagaacaatcaggccacccaagcaaggatgcaagaaacaaat
gctgaaattcttaaaatgaaagccgaattagaggcagtaaaagcaagcgctgaaaaagat
gcgttaacaggccttaaaaacagaggcgcgtttgataaagcgatagataacgttgttcat
agtgaaaccaatttaagtgcaaccctggttctacttgatattgatcactttaagcgtgta
aacgataattttggccaccttgtcggcgatcgagttattcgttacgtttccgcactttta
acccagattgttggctcagagcaccatattgctaggtatggtggtgaagaatttgcagtt
attttaaccggcctagatattgacaacgcgaagcagctgacggaaaaaatacgtattgca
atgagcaacagtaagctgcaacgaaaagaaagcggtgaagccattggagaggtaacaatc
tccgcaggtatcgcaacagttaaagcaaccgatagtgttgaactgttaattgatcgcgcc
gataaagcactgtaccaagcaaaagaagcaggccgaaataaggttgttatagccgcataa

DBGET integrated database retrieval system