KEGG   Cycloclasticus sp. P1: Q91_1386Help
Entry
Q91_1386          CDS       T02265                                 

Gene name
dapE
Definition
(GenBank) Succinyl-diaminopimelate desuccinylase 1
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cyq  Cycloclasticus sp. P1
Pathway
cyq00300  Lysine biosynthesis
cyq01100  Metabolic pathways
cyq01120  Microbial metabolism in diverse environments
cyq01230  Biosynthesis of amino acids
Module
cyq_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:cyq00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Q91_1386 (dapE)
Enzymes [BR:cyq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Q91_1386 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AFT67423
UniProt: K0C4I5
Position
1460578..1461705
Genome map
AA seq 375 aa AA seqDB search
MSDTLNLTLALLKKQSLTPNDAGCMDLMAEYLQERGFKIEWMNFGETRNMWARKGSEAPL
FCFAGHTDVVPTGPLEEWSTPPFEPTIKDGLVYARGAADMKGSLAAMMTACDRFITEHST
HNGSISFLITSDEEGPAHDGTVKVIDTLNQRKEKIDFCIVGEPSSHKRFGDMVRVGRRGS
INGYLTLFGKQGHVAYPELVDNPIHALAPILSKITAEKWDEGNEYFPPTSFQISNINAGT
GVENVVPGQLNLVFNLRFSSELTPEDIKRRITYIVDQNSDNYELSWQVSGLPFLTEKGTL
TNAVEQAIYELTGSTPVLSTGGGTSDGRFIAPSGAQLIELGPINETIHKVNECVRIDDLD
TLSLTYSKILENILL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatacattaaacctcacccttgccttacttaaaaagcaatcacttacgcctaac
gatgcaggctgcatggacttgatggcagagtacctgcaagaacgtggcttcaaaatagag
tggatgaacttcggcgaaacacgcaatatgtgggcaagaaaaggcagcgaagcgccgtta
ttttgttttgcaggtcataccgatgtggtacctacgggtccactagaagaatggagtact
ccaccttttgaacctaccatcaaggatggcttggtctatgcccgtggtgccgctgacatg
aaaggcagtttagcggcaatgatgactgcttgtgatcgttttattaccgaacatagcact
cacaacggctctatttcgttcttaatcactagcgatgaagaaggccccgcccatgatggt
actgttaaagtcattgacacactgaaccagcgcaaagaaaaaatcgatttttgtatcgtt
ggtgaaccgtcgagccataaacgttttggtgatatggtacgcgttggtcgacgcggttcg
atcaatggttatttaaccttatttggtaaacaaggccatgttgcttaccccgaattagtc
gataaccctatccatgccctagcccctattttgtcaaaaataacggcagaaaaatgggat
gagggtaatgaatatttccccccaactagctttcaaatctctaatattaatgctggaacc
ggtgttgaaaatgttgttcctgggcaacttaatttagtgttcaatctacgtttctcgagc
gaattaacacccgaagacattaaacggcgtatcacttacatagtggaccaaaattcagat
aattatgagcttagttggcaggtatccggtttaccatttctgaccgagaaaggaacatta
accaacgctgttgaacaagccatttatgaactaaccggcagtacacctgttttatcgact
ggcggcggcacatctgatggtcgctttattgccccaagtggtgcccagctcattgagcta
ggccccattaacgaaacaatccataaggttaatgaatgcgtccgtattgacgatttagac
acattatcactgacctactctaaaatactagaaaatattttactttaa

DBGET integrated database retrieval system