KEGG   Cycloclasticus sp. P1: Q91_1420Help
Entry
Q91_1420          CDS       T02265                                 

Definition
dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (Succinyl-transferring) complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cyq  Cycloclasticus sp. P1
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:cyq01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cyq00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cyq00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1492990..1494246
Genome map
AA seq 418 aa AA seqDB search
MSIEVVVPSLPESVADATLVTWHKQAGDTVLKDENLVDLETDKVVLEVPALSDGVLAEII
EPEGSTVLSGQLLARIEAGSAKPETPSPKATPAKSEPATTTLPAEKNSGSTEALSPAVRK
LVAEHGLDPQQIAASGKGGRITKTDVLNHIKQQSSNGVTTASATMSNSAPSKAAKATPMP
TLPTSERAEQRVPMTRLRAKIAERLIQAQQNTAMLTTFNEVNMQPIMDIRSKYKDQFSKV
HDTKLGFMSFFVKAAVESLKLFPSVNASVDEQDIIYHGYYDIGIAVSSPRGLVVPVLRDA
DLKNFAAIESGIAEFGIKARDGKLGIDDLTGGTFTITNGGVFGSMMSTPILNPPQSAILG
MHAINQRVMVENGEMVIRPMMYLALSYDHRIIDGKEAVSFLVTIKDFLEDPARLLLNV
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgagcattgaagtcgtagtacctagccttccagaatccgttgccgatgccactttagta
acttggcataaacaagccggtgacaccgttttaaaagatgaaaatctagttgacctcgaa
acagataaagtagttttagaagtccctgcactgtcagatggtgtgttagcagaaatcatt
gagccagaaggttctactgtattaagtggccaattgctggctcgcatagaagctggtagc
gccaaaccagaaaccccaagcccaaaagcaacaccggcaaaatcagaaccagcaacaaca
actttacctgctgaaaaaaattcaggttcaactgaagcacttagtcctgctgttagaaaa
ctcgttgctgagcatggattagacccccaacaaattgcagcctcaggtaaaggcggcaga
atcaccaaaaccgatgtgctaaaccatatcaagcaacagtctagtaatggcgtcacaaca
gcttcagcaaccatgagcaattcggcaccgagcaaagcggctaaggcaacaccaatgcca
actttaccaacaagtgagcgtgcagaacaacgtgtgccgatgacacgccttcgagcaaaa
attgcagagcgcttaattcaagcacagcaaaacacggccatgttaacaacgtttaacgaa
gtaaacatgcagcctattatggacattcgcagtaaatataaagatcaattctcgaaagtt
catgatacaaaattaggctttatgtcattttttgttaaagcagccgttgagtcacttaag
cttttcccatcagtcaacgcctctgttgatgaacaagatattatttaccatggttattat
gatatcggcattgccgtttcatcacctcgcggcttagtagtgccggtactgagagatgca
gacctgaaaaattttgccgccattgaaagcggtattgctgaatttggtatcaaagcccgt
gatggaaaattaggcatcgatgatctaaccggcggtacatttacaatcactaatggtggt
gtatttggatcaatgatgtcgactcctattttgaacccaccacaaagtgctattttgggc
atgcatgccattaaccaacgagtgatggtagaaaacggtgaaatggttatacgtcctatg
atgtatctagccttatcttatgatcatcgaattatcgatggtaaagaagcagtgtccttt
ttagtcactataaaagacttcttagaagaccccgcaagattactgttaaacgtttaa

DBGET integrated database retrieval system