KEGG   Cycloclasticus sp. P1: Q91_1447Help
Entry
Q91_1447          CDS       T02265                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cyq  Cycloclasticus sp. P1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cyq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Q91_1447
   01230 Biosynthesis of amino acids
    Q91_1447
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Q91_1447
   00051 Fructose and mannose metabolism
    Q91_1447
   00562 Inositol phosphate metabolism
    Q91_1447
Enzymes [BR:cyq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Q91_1447
Exosome [BR:cyq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Q91_1447
  Exosomal proteins of bladder cancer cells
   Q91_1447
  Exosomal proteins of melanoma cells
   Q91_1447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1531799..1532545)
Genome map
AA seq 248 aa AA seqDB search
MRRSLVIGNWKMNGSLDSTSEILRAIETTIDDKITCDIGVCVPFVYIAAAQEITKPTVIT
IGAQTVSEYQSGAYTGEVSAHMLEDVGCSWVLIGHSERRTLFNEANAQLVKKVLAAQMTG
VTPVYCVGETQEEYKSGATFDVINDQVEALLNNSAVDLTQLVLAYEPVWAIGTGLTASPE
EAQKVHAFIRALVSERDVNAANMLRILYGGSVKPDNAMSLFGQKDIDGGLIGGASLDAKA
FVSICQKA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgatcactggttattggaaactggaagatgaatggttcacttgactcaacaagt
gaaattttacgtgcaattgaaacgacaattgatgataaaataacgtgtgatataggagtc
tgcgtgcctttcgtctatatagcggctgcacaagaaataactaaaccgacagtgataacc
ataggtgctcaaactgtttcagagtatcagtctggggcatataccggtgaagtgtcggcg
catatgttggaagatgttggctgtagctgggtactaataggtcactcagaaaggcgaaca
ctatttaatgaagcaaatgcgcagctggttaagaaagtgctggcagcccaaatgactgga
gttactcctgtttattgtgttggtgaaacacaggaagaatacaagtctggtgctacattt
gatgtaattaacgatcaggttgaggcgttattaaataatagcgctgtagatttgacgcaa
ctggttctggcttatgaacccgtttgggccattggaacggggttaacggcctcccctgaa
gaagctcaaaaggtgcatgcttttataagagcattggttagcgagagagatgtaaatgca
gctaacatgcttcgcattttatatggcggaagtgtaaaaccagataatgcaatgtcattg
tttggacaaaaagatattgatggtggtttgataggtggcgcatccttggatgcaaaagcg
tttgtttcaatttgccaaaaagcgtaa

DBGET integrated database retrieval system