KEGG   Cycloclasticus sp. P1: Q91_1449Help
Entry
Q91_1449          CDS       T02265                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cyq  Cycloclasticus sp. P1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Q91_1449 (folP)
Enzymes [BR:cyq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Q91_1449 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1533986..1534765)
Genome map
AA seq 259 aa AA seqDB search
MGVLNITPDSFSDGGSFTQIESAVQHALKMAEQGATIIDIGGESTRPNALPVSTDEEIQR
VVPVIEGIRLKSDIAISIDTSKADVMKAAIEAGADFINDVYALQRPGSLDMAASLGVPVC
LMHMQADPTTMQDQPYYLNVVEELNDFFAQRIAACEQVGIAKGKIILDPGFGFGKTLQHN
LTLLAKLKEFESHGCPILAGLSRKSMFGQLLDKKVDERLIGSVSAALLAVANGASIVRVH
DVAETADALKVYMAVQAAK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgggggttcttaatattacgccggattctttttctgacggaggttcttttacacagata
gaatcagcggtgcaacatgccttgaagatggctgagcaaggcgccacaattattgatatt
ggcggtgaatctacacggcctaatgcattacctgtttctacagacgaggaaatccaaagg
gtggttcctgttattgaagggattcgacttaaatcggatattgccatttcaattgatacc
agcaaagctgatgttatgaaggctgccatagaggccggagcggactttatcaatgatgtg
tatgccttacagagaccgggttcactggatatggcggcttctttaggagtgcctgtctgt
ttaatgcatatgcaagcagaccctaccacgatgcaagatcaaccatattaccttaatgtg
gttgaagaactgaatgatttttttgctcagcgtatagcggcctgtgagcaagttggtatt
gctaaagggaagattatattagacccagggtttggctttggtaaaaccttacaacataac
ctgacattattggcgaaacttaaagagtttgagagccatggctgcccaatattggccggc
ctatcaagaaaatcaatgtttggtcagttattagataaaaaagtcgatgagagattaatt
ggcagtgttagtgccgcgttgttagcagtggctaatggtgcgtctattgttcgtgtgcat
gatgttgctgaaacagctgatgcgttaaaagtctatatggctgttcaggctgccaaatga

DBGET integrated database retrieval system