KEGG   Cycloclasticus sp. P1: Q91_1490Help
Entry
Q91_1490          CDS       T02265                                 

Definition
acetaldehyde dehydrogenase 5
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
cyq  Cycloclasticus sp. P1
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cyq00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:cyq00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:cyq00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:cyq00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:cyq00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1576014..1576928
Genome map
AA seq 304 aa AA seqDB search
MEKIKCALIGSGNIGTDLIYKIQRSPYLEPVWMVGIDPKSEGLLRAKNMGLKVTSDGVDG
LLPHVLEDNIQIAFDATSAYVHAENSRKLNELGVLMIDLTPAAIGPLCVPPVNLSQHTEK
LEMNVNMISCAGQATIPIISAVSGIQSVEYAEIVASLASKSVGIGTRENLDEFTYTTSGA
IETVGGARKGKALAIINPAEPPLIMRNTIYCITDDKPQEDKIVESILNMIEEVKKYVPGY
KLINGPIFDGNKISVFMEVEGLGDYLPKYAGNLDVMTAAATRTAEMFAEEIQNGTITLKP
VEAA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaatcaagtgcgcattgattggatctggcaatattggcacagatcttatctat
aaaattcaaagaagcccttatcttgaacctgtttggatggtaggtattgatccaaagtct
gaaggtttgctccgcgctaaaaatatgggcctcaaggtaacctctgatggtgtcgatggt
ttattacctcatgtgcttgaggacaatattcaaatagcctttgatgcaaccagtgcctat
gttcacgctgaaaacagccgtaaacttaatgagcttggcgtgttaatgattgatttaaca
ccagccgctattggccccttatgtgtcccacccgttaacttaagccagcatactgaaaag
cttgaaatgaacgtaaatatgatttcatgtgcagggcaagccactattcctattatcagc
gcggtatcaggcattcaatctgttgagtatgcagagattgtggccagccttgcttcaaag
tctgttggcattggtactcgtgaaaaccttgacgagttcacctatacaacctccggcgct
attgaaacggttggcggtgctcgtaaaggcaaagccttagctattattaaccctgctgag
ccgccacttattatgcgtaatactatttactgtattaccgatgataaaccacaggaagac
aagatcgttgagtccatcctaaatatgattgaagaagttaaaaagtacgtcccaggctac
aaacttattaatgggcctatttttgatggcaataaaatttctgtgtttatggaagttgaa
gggcttggtgactatttacccaaatacgctggcaaccttgatgtaatgactgctgctgcc
actagaacggcagagatgttcgcggaagaaattcaaaatggaacaataactcttaaacct
gtggaggctgcgtaa

DBGET integrated database retrieval system