KEGG   Cycloclasticus sp. P1: Q91_1564Help
Entry
Q91_1564          CDS       T02265                                 

Gene name
recR
Definition
Gap repair protein with type I DNA topoisomerase domain
Orthology
K06187  
recombination protein RecR
Organism
cyq  Cycloclasticus sp. P1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cyq03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1652929..1653525)
Genome map
AA seq 198 aa AA seqDB search
MQSEPILQDLIQALRCLPGVGQKSAQRMAFHLLERDRQGAFKLAQSLAEAVDKIGHCSVC
QTLSSADICGLCSDDRRDQQLLCIVETPADVMAIDGATSFKGVYFVLNGRLSPLDGLGPA
DIGLDKLVDRLKMGVIKEIILATNPTVEGEATAHYISEMAKKYSVRATRIAHGVPFGGEL
EYIDSGTLSHAFSGRSEV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcaatctgaacccattcttcaagaccttattcaggcattgcgctgtttaccgggtgtc
ggtcaaaagtcggcccaacgaatggcgtttcatctactagaacgtgaccgtcagggcgcc
tttaaattggcgcaaagccttgcagaagcggtggataaaattggacactgttcggtttgt
caaacgttgtcgtctgctgatatttgcggattatgttcagatgatcgccgtgatcaacag
ttattatgtattgtggaaacacctgctgatgtgatggcgatagacggtgcaacctctttt
aaaggggtgtattttgtgttgaacggccgcttgtctccgctcgatggcttgggaccagcg
gacatcggtttggataaattggttgatagactgaaaatgggcgtcattaaagaaattatt
ttggcgactaatccaacggttgaaggtgaagcaacagcgcattatattagtgagatggca
aaaaaatactccgttagggctacgcgtatagcgcacggtgtgccttttggcggcgagttg
gaatatattgatagtggtacgttgtctcacgcgtttagtggacgtagtgaagtttaa

DBGET integrated database retrieval system