KEGG   Cycloclasticus sp. P1: Q91_1597Help
Entry
Q91_1597          CDS       T02265                                 

Definition
glutathione peroxidase protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cyq  Cycloclasticus sp. P1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cyq00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Q91_1597
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Q91_1597
Enzymes [BR:cyq01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Q91_1597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1688656..1689210)
Genome map
AA seq 184 aa AA seqDB search
MMSNSIYDIALTKIDGNESTLSDYQGKVMLIVNVASKCGLTPQYEGLEALYQAYQDKGLV
VLGLPCNDFAGQEPGSEAEIQAFCSTNYAVNFPLYSKVNINSSPRHPLYEWLINAQPTSK
QLEGGQLMSRLAEKGLSPAVESDVSWNFEKFLVARDGSIKGRFAPDIKPDDASLINAIEE
ALNA
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtaactcaatttacgatatagcgctaactaaaattgacggtaacgaatcaacc
ctctctgactaccagggaaaggttatgctgattgttaatgtggcttctaaatgcggctta
acccctcaatatgaaggtttagaagcgctttatcaagcatatcaagacaaaggcttggtg
gtattgggtttgccttgtaatgattttgcagggcaagaaccgggcagtgaggctgaaatt
caagcattttgttcaacaaactatgccgtcaattttccgctgtacagtaaagtaaacata
aatagcagcccaaggcatccgctatacgaatggcttattaatgcccagccaacaagcaaa
cagctggaaggtggtcagttaatgagccggctggcagaaaagggtttatcgccagcggta
gaaagcgatgtcagctggaattttgaaaaatttctagtggcgcgtgatggttcaattaaa
ggccggtttgcgcctgatataaagcctgatgatgcaagccttattaacgcgattgaggaa
gcgttgaacgcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system