KEGG   Cycloclasticus sp. P1: Q91_1597Help
Entry
Q91_1597          CDS       T02265                                 

Definition
glutathione peroxidase protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cyq  Cycloclasticus sp. P1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:cyq00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:cyq00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1688656..1689210)
Genome map
AA seq 184 aa AA seqDB search
MMSNSIYDIALTKIDGNESTLSDYQGKVMLIVNVASKCGLTPQYEGLEALYQAYQDKGLV
VLGLPCNDFAGQEPGSEAEIQAFCSTNYAVNFPLYSKVNINSSPRHPLYEWLINAQPTSK
QLEGGQLMSRLAEKGLSPAVESDVSWNFEKFLVARDGSIKGRFAPDIKPDDASLINAIEE
ALNA
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtaactcaatttacgatatagcgctaactaaaattgacggtaacgaatcaacc
ctctctgactaccagggaaaggttatgctgattgttaatgtggcttctaaatgcggctta
acccctcaatatgaaggtttagaagcgctttatcaagcatatcaagacaaaggcttggtg
gtattgggtttgccttgtaatgattttgcagggcaagaaccgggcagtgaggctgaaatt
caagcattttgttcaacaaactatgccgtcaattttccgctgtacagtaaagtaaacata
aatagcagcccaaggcatccgctatacgaatggcttattaatgcccagccaacaagcaaa
cagctggaaggtggtcagttaatgagccggctggcagaaaagggtttatcgccagcggta
gaaagcgatgtcagctggaattttgaaaaatttctagtggcgcgtgatggttcaattaaa
ggccggtttgcgcctgatataaagcctgatgatgcaagccttattaacgcgattgaggaa
gcgttgaacgcttaa

DBGET integrated database retrieval system