KEGG   Cycloclasticus sp. P1: Q91_1633Help
Entry
Q91_1633          CDS       T02265                                 

Gene name
hisD
Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
cyq  Cycloclasticus sp. P1
Pathway
cyq00340  Histidine metabolism
cyq01100  Metabolic pathways
cyq01110  Biosynthesis of secondary metabolites
cyq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cyq00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Q91_1633 (hisD)
Enzymes [BR:cyq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Q91_1633 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh ECM11 DUF5066
Motif
Other DBs
NCBI-ProteinID: AFT67667
UniProt: K0C7K6
Position
complement(1727177..1728475)
Genome map
AA seq 432 aa AA seqDB search
MNIQTLNASSTDFDQSLADLLAWDDVEDSSVNQTVSEIIQAVRQHGDAALLSYTQEFDQW
EASADNLVVEQEQLASAWDQLPDEHSKALKVAADRIRHYAEQQKAQSWDFVDEMGNTLGQ
KVTPLERVGVYVPGGKAAYPSSVLMNIIPAKVAGVSQIVMVTPTPKGELNALVLAAAWLA
GVDKVIKVGGAQAVAALAYGTETVPRVDKIVGPGNIFVATAKKMVFGQVGIDMIAGPSEI
LIVCDGKTNPDWIAMDLFSQAEHDEKAQSILVSLDEGFIEAVKASIKKLLPTLERSQVIK
ASLEGRGGFIYAETKEQTISIANKIAPEHLELSVDNAEQWAEEIEHAGAIFIGRYTPEAL
GDYCAGPNHVLPTSGTARFSSPLGVYDFQKRTSMINCSKTGASALSDTASILARGEALTA
HAKSAEYRKING
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaatatacaaacgttgaacgcatcgagtactgattttgatcaatcacttgctgatttg
ttggcttgggatgatgtagaagatagctcggttaatcaaaccgtcagtgaaataatacag
gctgtccgccagcatggtgatgcggcgctattgtcatatactcaagagtttgatcaatgg
gaagccagcgccgataaccttgttgttgaacaagagcagctcgctagtgcttgggatcaa
ttaccggatgagcactcaaaggcacttaaagtcgccgctgataggattcgtcactatgcc
gaacagcaaaaagcacaatcatgggattttgtcgatgagatgggtaatacgctcggtcag
aaagttaccccacttgaacgtgttggtgtatatgtgccgggcggtaaagcggcataccca
tcttcagtgttgatgaatattattcctgcgaaagtagcgggcgtatcacagattgtaatg
gttaccccgactcctaagggcgaactaaacgcattagttcttgcggctgcctggcttgcg
ggcgtagataaggtgattaaagtgggtggggcgcaagccgtggcagcgcttgcttatgga
acagaaaccgtgccgagagttgataagattgttgggccgggcaatatttttgtcgcgaca
gcaaaaaagatggttttcggccaagtaggtatagacatgattgctggtccgtctgaaatt
cttattgtttgtgatggaaaaaccaatccagattggatagcgatggatcttttttcgcaa
gcagaacatgacgaaaaagcgcagtcgatactcgtttcactagatgaagggttcattgaa
gcggttaaggcgagcataaaaaaattacttcctacgcttgagcgttcacaggtcataaaa
gcctcattagaaggtaggggtgggtttatttatgcagaaacaaaagaacaaacgataagc
attgctaataaaatagcgccagagcatcttgagttatcagtagataatgctgagcagtgg
gctgaagagattgaacacgcgggtgcaatatttataggtagatacacgccggaagcactg
ggcgattattgcgctggacctaaccatgtcttaccgacatctggcacagcgagattctca
tcaccactgggcgtttatgattttcaaaagcgcactagcatgattaattgcagtaaaact
ggggcctcagcactctctgatacagcgtctattttggcgcgcggtgaggctttaacagcc
catgcaaaatctgcagaataccgtaaaataaacggctag

DBGET integrated database retrieval system