KEGG   Cycloclasticus sp. P1: Q91_1791Help
Entry
Q91_1791          CDS       T02265                                 

Definition
limonene-1,2-epoxide hydrolase catalytic domain-containing protein
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
cyq  Cycloclasticus sp. P1
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyq00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Q91_1791
Enzymes [BR:cyq01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     Q91_1791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1885774..1886166)
Genome map
AA seq 130 aa AA seqDB search
MLVTNNEETVKRFCEAWDEMDQDTILSLMSDDAVYHNLPLGPLKGREQIAGSVEGFLKMT
ASTEFKILTLVADGKRVVTERVDTFAFKDGTMMEELPVLGIFEFDNNGKISSWREYWDMQ
DWLKRGGPVL
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgctggtaaccaataatgaggaaacggttaagcgattctgtgaggcttgggatgaaatg
gatcaggatacaatcttatcgttaatgagtgatgatgctgtttaccataacttaccgcta
gggccattaaagggccgcgagcaaatagcaggctctgtagaaggttttttaaagatgaca
gcaagcactgaatttaaaatattaaccttggtggcagatggtaagcgtgttgtaaccgaa
cgagtcgatacctttgcttttaaagatggcacgatgatggaagaactgccagtattaggt
atatttgagtttgataataatggcaaaataagttcgtggcgtgagtattgggatatgcaa
gattggcttaaacgtggtggaccagtgttatag

DBGET integrated database retrieval system