KEGG   Cycloclasticus sp. P1: Q91_1797Help
Entry
Q91_1797          CDS       T02265                                 

Definition
Formamidopyrimidine-DNA glycosylase (FAPY-DNA glycosylase, DNA-(Apurinic or apyrimidinic site) lyase MutM, AP lyase MutM)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cyq  Cycloclasticus sp. P1
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:cyq03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1892472..1893287
Genome map
AA seq 271 aa AA seqDB search
MPELPEVETTRRGIAPHIEGKQVSQVIVRQAKLRWPVSPEVSTLLPGLCINHVKRRAKYL
LLETDKGTLIIHLGMSGSLRIVQASTTPEKHEHIDIIFSNNTCLRYKDPRRFGSLLWSTD
VIENHKLIQHLGPEPLSDAFNIDDFYPKAQLKKTPIKSFIMDGQVVVGVGNIYASEALFQ
AGIHPKRAANKVSKKRLINLVFAIKKILAQAIQQGGTTLKDFVNSDGNPGYFQQTLNVYG
QKDKPCPRCKAPIKQIIIAQRSTFYCTHCQR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagttaccagaagtcgaaacgactcgtcgcggaattgcccctcatattgaaggc
aaacaagtttcacaggtcattgtccgacaagcaaaattacgttggcccgttagcccagaa
gtttccaccttattaccgggtctttgcattaaccatgttaaacgtcgtgcaaaataccta
ttgcttgaaaccgataagggcacgttaattatccacctgggcatgtcgggtagtttacgc
atcgttcaggcttcaacgacaccagaaaaacacgagcatattgacattatttttagtaat
aacacctgcttgcgctataaagatccgcgccgtttcggttcgctgttatggtcaacagat
gtcattgaaaatcacaaattaatacaacaccttgggccagagcctttatccgacgcattt
aatattgacgatttttacccaaaggctcaattaaaaaaaacacccattaaaagttttatt
atggatgggcaagtcgttgtcggcgttggtaatatttatgctagcgaagcattatttcag
gcaggcattcaccctaaacgtgccgctaacaaggtttctaaaaagcgcttgattaacctc
gtttttgccattaaaaaaatcctagcgcaagctatacaacaaggcggcacaacgttaaaa
gattttgttaacagtgacggcaaccctggttattttcaacaaacacttaatgtttacggg
caaaaagacaaaccttgcccaaggtgcaaagcacccattaaacaaatcattattgctcaa
cgatcgaccttttactgcacccactgccaacgttaa

DBGET integrated database retrieval system