KEGG   Cycloclasticus sp. P1: Q91_1797Help
Entry
Q91_1797          CDS       T02265                                 

Definition
Formamidopyrimidine-DNA glycosylase (FAPY-DNA glycosylase, DNA-(Apurinic or apyrimidinic site) lyase MutM, AP lyase MutM)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cyq  Cycloclasticus sp. P1
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:cyq00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Q91_1797
Enzymes [BR:cyq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Q91_1797
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Q91_1797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1892472..1893287
Genome map
AA seq 271 aa AA seqDB search
MPELPEVETTRRGIAPHIEGKQVSQVIVRQAKLRWPVSPEVSTLLPGLCINHVKRRAKYL
LLETDKGTLIIHLGMSGSLRIVQASTTPEKHEHIDIIFSNNTCLRYKDPRRFGSLLWSTD
VIENHKLIQHLGPEPLSDAFNIDDFYPKAQLKKTPIKSFIMDGQVVVGVGNIYASEALFQ
AGIHPKRAANKVSKKRLINLVFAIKKILAQAIQQGGTTLKDFVNSDGNPGYFQQTLNVYG
QKDKPCPRCKAPIKQIIIAQRSTFYCTHCQR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagttaccagaagtcgaaacgactcgtcgcggaattgcccctcatattgaaggc
aaacaagtttcacaggtcattgtccgacaagcaaaattacgttggcccgttagcccagaa
gtttccaccttattaccgggtctttgcattaaccatgttaaacgtcgtgcaaaataccta
ttgcttgaaaccgataagggcacgttaattatccacctgggcatgtcgggtagtttacgc
atcgttcaggcttcaacgacaccagaaaaacacgagcatattgacattatttttagtaat
aacacctgcttgcgctataaagatccgcgccgtttcggttcgctgttatggtcaacagat
gtcattgaaaatcacaaattaatacaacaccttgggccagagcctttatccgacgcattt
aatattgacgatttttacccaaaggctcaattaaaaaaaacacccattaaaagttttatt
atggatgggcaagtcgttgtcggcgttggtaatatttatgctagcgaagcattatttcag
gcaggcattcaccctaaacgtgccgctaacaaggtttctaaaaagcgcttgattaacctc
gtttttgccattaaaaaaatcctagcgcaagctatacaacaaggcggcacaacgttaaaa
gattttgttaacagtgacggcaaccctggttattttcaacaaacacttaatgtttacggg
caaaaagacaaaccttgcccaaggtgcaaagcacccattaaacaaatcattattgctcaa
cgatcgaccttttactgcacccactgccaacgttaa

DBGET integrated database retrieval system