KEGG   Cycloclasticus sp. P1: Q91_1833Help
Entry
Q91_1833          CDS       T02265                                 

Gene name
gmk
Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cyq  Cycloclasticus sp. P1
Pathway
cyq00230  Purine metabolism
cyq01100  Metabolic pathways
Module
cyq_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cyq00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Q91_1833 (gmk)
Enzymes [BR:cyq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Q91_1833 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 AAA_22 MMR_HSR1 cobW RsgA_GTPase MobB AAA ABC_tran AAA_18 NTPase_1 TsaE AAA_19 AAA_30 CPT AAA_35
Motif
Other DBs
NCBI-ProteinID: AFT67867
UniProt: K0C847
Position
complement(1924932..1925549)
Genome map
AA seq 205 aa AA seqDB search
MTRTGQLFIVSAPSGAGKTSLVKALLETLSDIEVSVSSTTRAPRSGEVSGIDYHFISEEG
FQQVVAQDGFLEYATVFGNSYGTSKRLVDEKLAQGVDIILEIDWQGAQQVRRVMKDSCSI
FILPPSKQVLEERLRGRGLDSDEVINKRMRTAVDEMVHHEEYDFLVVNDDFEVALDELAM
IVKTQRLAMKRGKLTHSALINQLLN
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgacgagaacagggcaattatttatcgtatctgcaccctcgggggctggtaaaacaagt
ttagtgaaggcgttattagagacactctcagatattgaggtgtctgtttcaagtacaacg
agagcaccacggtcaggtgaggtgagtggtattgattatcactttatcagcgaggaaggc
tttcaacaggttgttgcgcaagatggctttttagaatacgcgactgtttttggcaattca
tatggaacgtccaagcgcttagttgatgaaaagttagcacaaggggtggatattattcta
gagattgactggcaaggggcgcaacaagttcgccgtgtgatgaaggatagctgttcaata
tttattttgccaccgtccaaacaggttctcgaggaaaggttgcgaggacgtgggttagat
agcgacgaggttatcaataaacgaatgcgtacagcagtggatgaaatggtgcatcatgaa
gaatatgatttcttggtggtcaatgatgattttgaagtggctttggacgagctagccatg
attgtaaagactcaacgattagccatgaaaaggggaaaactcacccactcggctttgatt
aatcagttgcttaattaa

DBGET integrated database retrieval system