KEGG   Cycloclasticus sp. P1: Q91_1907Help
Entry
Q91_1907          CDS       T02265                                 

Gene name
aceF
Definition
(GenBank) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cyq  Cycloclasticus sp. P1
Pathway
cyq00010  Glycolysis / Gluconeogenesis
cyq00020  Citrate cycle (TCA cycle)
cyq00620  Pyruvate metabolism
cyq01100  Metabolic pathways
cyq01110  Biosynthesis of secondary metabolites
cyq01120  Microbial metabolism in diverse environments
cyq01130  Biosynthesis of antibiotics
cyq01200  Carbon metabolism
Module
cyq_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cyq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Q91_1907 (aceF)
   00020 Citrate cycle (TCA cycle)
    Q91_1907 (aceF)
   00620 Pyruvate metabolism
    Q91_1907 (aceF)
Enzymes [BR:cyq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Q91_1907 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 HlyD_3 RnfC_N SpoIIID MEF2_binding
Motif
Other DBs
NCBI-ProteinID: AFT67941
UniProt: K0C8V8
Position
complement(1994136..1995737)
Genome map
AA seq 533 aa AA seqDB search
MSDLIDVAVPDIGDFDAVEVIEVLVSIGDSVEVEQALLTLESDKASMEIPSSAAGVVEEI
LVTVGDFVAEGTVVVRLKELNSSEQAKAPAQEAAAEPVQEEVTESEINIHVPDIGDFDAV
EVIEVNVAVGDVVEEEQSLLTLESDKASMEIPSTSAGTVKEVKVAVGEQVSEGDLIVVLS
GQAAATVKAESPAKSEPKAEEKAPAKPAPKSQTNTNPNTNVAAAPVTSKPMGHIHASPTV
RKFARELGVDLSTVTKATGPKGRLLKEDIKQHVKQIIAGQSATSSSVGSGIPPIPEVDFT
KFGEIEEKPLSKIKRLTGTNLTRAWLNVPMVTHHELADITDMEAFRKSLKADAEKRGVKV
TFLAFMMKALVAALKEFPQFNASLSPDGNSLIYKKYYNIGIAVATPNGLVVPVFKDVDKV
SIFELAEQMGVISKKARDGKLSPKEMQGACMTISSLGGIGGTAFSPIVNAPEVAILGATR
AEMQPVWNGSEFIPRLMLPLDLTYDHRVIDGADAASFMVALSRYLNDIRRVLL
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatttaatagatgtagcggtgccagatattggtgattttgatgctgttgaggtt
attgaagtcttagtttctatcggtgattcagttgaggtagaacaagccttgttgacgtta
gagagtgataaggcaagtatggaaatcccttcatcagcagcaggggtggtcgaagaaatt
ttagtgacggttggcgactttgtggcagaaggcactgttgtcgttcgcctaaaagagctt
aactcgtcagagcaagcgaaggcaccagctcaagaagcagcagctgaaccagtacaagaa
gaagtaacagaaagcgaaattaatattcatgtcccagatattggtgactttgatgccgtt
gaagttattgaagtgaatgtcgctgtcggcgatgtggttgaagaagaacaatcgttgtta
accttagaaagtgacaaagccagtatggagattccttcgacctcagcaggtaccgttaaa
gaggttaaagtcgccgtcggtgagcaagtctcagaaggtgatttaattgtagttttatcc
ggccaagcggctgcaacagtgaaggctgagagtccggcaaagtctgagccaaaagcagaa
gaaaaagcgccagcaaagccagcgccgaaatcgcaaacgaataccaatcccaataccaat
gttgcagcggcaccggtgacttcaaaaccaatgggacatattcatgcaagtccaacggta
cgcaagtttgcaagagagttgggtgttgatttatcaacggttaccaaggcaacagggcct
aaaggccggcttttaaaagaagacattaaacaacacgttaagcaaattattgccggccaa
tcagcgacgtcttcatcagttggctcggggattccacctattccagaggttgattttaca
aaatttggtgaaatagaggaaaaaccgctcagtaagattaagcgcttaacaggcacgaat
ttaacgcgtgcttggctgaatgtgccgatggtgacacatcatgagctagcagacattact
gatatggaagcgttccgtaaatcattaaaagcagatgctgaaaaacggggtgtgaaggtc
acgtttttagcatttatgatgaaggctttagtggctgcattaaaagagtttccacagttt
aatgcctcgttatcgccagatggtaatagcttgatttataaaaaatattacaacattggt
atagctgttgcgacaccaaatgggcttgttgtacctgtctttaaagatgttgataaggtc
agtatttttgagttggctgaacaaatgggcgtgatcagtaaaaaagcaagggatggtaag
ctttcgccaaaggaaatgcagggcgcatgtatgacgatctcaagcctaggtggaattggc
ggtactgctttttcaccaattgttaacgcccccgaagtggcgatcttaggtgcgacacgt
gcagagatgcagccggtctggaatggtagtgaatttatcccccgcttaatgcttccatta
gatctcacttatgatcatcgcgtgatagatggtgcggatgctgcctcctttatggtagcg
ctttcacgttatctcaatgacatccgtcgtgtgttgttgtag

DBGET integrated database retrieval system