KEGG   Cycloclasticus sp. P1: Q91_1911Help
Entry
Q91_1911          CDS       T02265                                 

Definition
phosphoglucomutase/phosphomannomutase family protein
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
cyq  Cycloclasticus sp. P1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cyq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Q91_1911
   00030 Pentose phosphate pathway
    Q91_1911
   00051 Fructose and mannose metabolism
    Q91_1911
   00052 Galactose metabolism
    Q91_1911
   00500 Starch and sucrose metabolism
    Q91_1911
   00520 Amino sugar and nucleotide sugar metabolism
    Q91_1911
  Nucleotide metabolism
   00230 Purine metabolism
    Q91_1911
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Q91_1911
Enzymes [BR:cyq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Q91_1911
    5.4.2.8  phosphomannomutase
     Q91_1911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2000541..2002922)
Genome map
AA seq 793 aa AA seqDB search
MINKTILVLMLLVIALGGAGYVYLGQIDQQNIEQAEQLTKRTEKASDTLSAKVRAWRQAL
EDVAKAPALIEGLDGGETAATNWVAAQAALIDDIVSLRVVKPDLMQVDPTSKPPLGYATL
DLIRKVESSKKAQMPEVHMMETDHQHVVIALPVLDGETLRAVMLGAFEVPAIQTAFSVAI
GSEKEGFLTLKQGALKLVGDGASMHQMGESIGSVPVAGTHWRISIKRQALAAPITKAELF
TYLVGALVMVLLAGVLLALVKHKDKCREWVEVIKQSTSKASKKPLVLKDDDISPPEDEAR
EHKQIVDSIKEESVDAGDSTSSPIFMKDDVIDVVTQAEVPQSIFRAYDIRGIVDKTLTEQ
GVFLIGRAIASEALSVGQQTIAIARDGRLHSLRLSESLSKGIQAAGCNVIDVGQVPTPVL
YFATHQLDTQSGVMITGSHNPANYNGLKIVIAGNTLSGEAIQQLYQRIQQDNLETGEGAY
QEQMMLPEYIGAITGDVRLGRMMKVVVDCGNGVAGEAAPMLLSTLGCEVIPLYCEIDGNF
PNHHPDPSKPENLQTLIDKVREEEAELGLAFDGDGDRLGVVDSDGNIIWPDRQMMLYAVD
VLSRQAGADIIYDVKCTRNLAKVIAKHGGKPIMSQTGHSLIKAKMKETKAELAGEMSGHI
FFKERWFGFDDALYTAARLLEIVTAEFRSTAEIFAELPDSVSTPELNTSLAEGENFSFVE
KLQSQATFDEAKVITIDGIRVEFKDGWGLVRASNTTPSLVLRFEADNEVSLERIKDVFRE
QMLKINADIALPF
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgataaataaaacaatacttgtgctgatgttgcttgttattgctttgggtggtgcgggc
tatgtttacctcggtcagattgaccaacaaaatattgagcaagccgaacagttaaccaag
cggacagaaaaggcgagtgatactttatcagcaaaagtaagggcgtggcgtcaggcccta
gaggatgtggcgaaagcaccagctttgattgaaggcttggacggcggtgaaacagcggca
acaaattgggtggcagcacaagcagcgttgatagatgacatcgtatcgttacgagttgtt
aagccggacctgatgcaggttgatccgacgagtaagccgcccttgggctatgcaacgctg
gatctaattagaaaagtagagtcatcaaagaaagctcaaatgccagaagttcatatgatg
gagacagatcatcaacatgttgtaatagcactacctgtattagacggcgagacactgcga
gcagtgatgctcggcgcatttgaggtgccggccatacagacggcatttagtgtggccata
ggcagtgagaaagagggttttttaacgcttaagcaaggtgcgttgaagcttgttggtgat
ggcgcttcaatgcatcagatgggtgagagtattggcagtgtgccagtagcaggaacgcat
tggcgcataagtataaaaaggcaagcgttagcagcgcctattactaaagcagagttgttt
acctaccttgttggagcattggtaatggtgctgcttgcaggggtgttgcttgcccttgtg
aaacataaagataaatgtcgagaatgggttgaggtgataaagcaaagcacaagcaaggcg
tctaaaaagccgctggttttgaaagatgatgatatttccccaccagaagatgaggcgcgt
gaacataaacaaatcgtcgatagcattaaggaagaaagtgttgatgcgggtgactcaaca
tcaagtccaatttttatgaaagacgatgtaattgatgtggtaacccaagccgaagtgccg
cagtctatttttagggcatatgatattagagggattgttgataagacattgacagaacag
ggtgtgtttttgattggacgtgcgattgctagcgaagcgttaagtgtaggtcagcagact
atagcgattgctcgtgatggccggctgcacagtctaaggcttagcgagtcactatccaag
ggcatacaagctgcgggatgtaatgtgatagatgttggccaagtcccaacccccgtcttg
tattttgcaacccatcaactagacacccaatcaggggtaatgataacgggtagccacaac
ccagcaaattataatggtttgaaaattgttattgcgggtaatacgttgtcaggcgaggcg
attcagcagttatatcaacgcattcagcaagataacttggaaactggtgaaggcgcttac
caagagcaaatgatgttacctgaatatattggtgctattactggcgatgttcgtttaggc
agaatgatgaaagtagtggtcgattgcggtaatggagtggctggagaggctgccccaatg
ctactgtcgacgttaggctgtgaagtgattccgttgtattgtgagattgatggtaatttc
ccaaaccatcatcccgacccgagcaagccagagaatttacaaacgctgatcgacaaggtg
cgtgaggaagaggcggagctgggtttagcttttgatggcgatggcgatcgtttaggcgtg
gttgactcggatggcaatattatctggccggataggcaaatgatgttgtacgcggttgat
gtgctatctagacaagcaggcgcggacattatttatgatgtgaaatgtacacggaacctt
gccaaagtaattgccaaacatggcgggaagcccattatgtcgcaaacagggcattcactg
attaaagctaaaatgaaagagactaaagcagagcttgcaggtgagatgagcgggcatatc
tttttcaaagagcgttggtttggttttgatgatgctttatataccgccgcacgactatta
gaaattgtgacagcagagtttaggtcaacagccgagatttttgcagaactacctgacagt
gtgagcacccccgaattaaatactagtttggcagaaggtgaaaacttcagttttgttgaa
aaattgcagtctcaggcaacctttgacgaagctaaggttattaccattgatggtatccgt
gttgaatttaaagatggttgggggctggtcagagcatcgaatacaacgccttcgttagta
ttgcgctttgaagcggataatgaggtgtcgttagagcgtataaaagatgtatttagagaa
caaatgttgaaaattaatgcggacatagcgttacctttttaa

DBGET integrated database retrieval system