KEGG   Cycloclasticus sp. P1: Q91_1973Help
Entry
Q91_1973          CDS       T02265                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase, GalU protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cyq  Cycloclasticus sp. P1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Q91_1973 (galU)
   00052 Galactose metabolism
    Q91_1973 (galU)
   00500 Starch and sucrose metabolism
    Q91_1973 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Q91_1973 (galU)
Enzymes [BR:cyq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Q91_1973 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2066312..2067205)
Genome map
AA seq 297 aa AA seqDB search
MKVRKAVIPVAGLGTRVLPASKAIPKEMMPVVDKPVIQYVVEEAVAAGIKEIILVTRTGK
SAIEDHFDSHYELEAELARKNKTALLAAIQNIVPPEVSIISIRQPEAKGLGHAVHCAAST
VGGEPFVVILPDVLVNNGGDKTNDLMRMVVEFENTGAAQIMVGEVPDDKVQLYGIADCGG
VAPAFGESTAIKGLVEKPKQDESPSNLAVIGRYVLPGKIMSLLADGKPGAGGEIQLTDAI
DTLLELEPVEAYKMMGDTYDCGEKLGYLKANLAYGLQHSDTANGLRQFINALANEHE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagttcgaaaagcagtaatccccgttgcaggtttaggcacgcgtgtgttacccgct
agtaaagcgatcccaaaagaaatgatgccagtagtggataagccggttattcaatatgtg
gttgaagaagctgttgcggctggcattaaagaaatcattttggtgacgcgcacgggtaaa
tcggcaattgaggaccattttgattcgcattatgaacttgaggctgagttagcacgtaaa
aataaaacggcgttgttggcggctattcaaaatattgtccccccagaagtatcgattatt
tcaattcggcaacccgaagcaaaaggccttggtcatgcggtacattgtgctgcgagcacg
gttggcggcgaaccatttgtagttattttacctgatgtgttggtgaataacgggggtgat
aaaacgaatgacttaatgagaatggttgttgagtttgaaaacacaggtgcggctcaaatt
atggtcggcgaagtgccagacgataaagttcaactatatggtattgccgactgtggaggt
gtggccccagcgtttggcgaatctacagctattaaaggactcgtcgagaagccaaagcaa
gacgaatcgccttcaaatttagccgttattggtcgttatgtgctacctgggaagattatg
agtttgctagctgacggtaagcccggtgcgggtggcgaaatacaactcacggatgctatt
gatactctattagaattggagccagtggaggcctataaaatgatgggcgatacgtatgat
tgtggggaaaaactgggttatttaaaggctaatcttgcgtatggtttacagcatagtgac
acggccaacggtttgagacagtttatcaacgccttagctaatgagcatgaatag

DBGET integrated database retrieval system