KEGG   Cycloclasticus sp. P1: Q91_2033Help
Entry
Q91_2033          CDS       T02265                                 

Definition
phosphofructokinase domain-containing protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cyq  Cycloclasticus sp. P1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cyq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Q91_2033
   01230 Biosynthesis of amino acids
    Q91_2033
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Q91_2033
   00030 Pentose phosphate pathway
    Q91_2033
   00051 Fructose and mannose metabolism
    Q91_2033
   00052 Galactose metabolism
    Q91_2033
  Energy metabolism
   00680 Methane metabolism
    Q91_2033
Enzymes [BR:cyq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Q91_2033
Protein phosphatases and associated proteins [BR:cyq01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Q91_2033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2130713..2131975
Genome map
AA seq 420 aa AA seqDB search
MTTKNAFYAQSGGVTAVINASACGLIETARQHGDKIGKVYAGRNGIIGALTEDLIDTSLE
SDEDIAALRYTPSGAFGSCRYKLKSFEENRAEYERLIAVFKAHNIGYFFYNGGGDSQDTT
HKLSQLSQSLGHDLRCIGIPKTVDNDLPLTDNCPGFGSVAKYVAVSIREAGFDVASMART
STKVFVLEVMGRHAGWIAAAGGLAAEREGESPHIILFPEITFDQEKFLAKVESTVKKHGF
CCIVVSEGVRNPDGTFLAEAGTRDAFGHAQLGGVAPVVADMIKTAHGYKYHWAVADYLQR
AARHIASKTDVDQAYAMGKAAVELALNGKTAVMPTIVRTSNNPYQWEIGVGELKDVANVE
QMLPAHYISEDGFGITPECEEYLRPLIMGEDSPPYVNGLPQYVRLKNLPVEKILNEPFDL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaccactaaaaatgctttttacgctcaatctggcggtgtcaccgctgttatcaatgca
agcgcctgcgggctcattgaaactgcacgtcaacatggcgataaaataggcaaggtatac
gcaggccgtaatggcattattggcgccttgaccgaagaccttatagacacatcgttagag
tctgatgaagatattgccgccttacgttataccccttcaggtgcatttggttcatgtcgt
tataaattaaaaagctttgaagaaaaccgcgctgaatacgaacgtcttattgctgttttc
aaagctcataatattggttatttcttttacaatggcggcggtgattcacaagacaccacg
cataaactctcccaattaagtcaatcattaggacatgacttgcgttgtatcggcattcca
aaaactgtcgacaacgatttaccgcttactgataactgcccaggatttggctccgttgcc
aaatatgtggcagtttcaatacgtgaggctggctttgacgttgcctcaatggcacgcaca
tcaaccaaggtatttgtacttgaagtaatgggccggcatgcgggttggattgccgcagct
ggtgggttggcagctgaaagagaaggtgagtcaccacatattattttgtttcctgagatt
acgtttgaccaagaaaaatttctagccaaagttgagagcactgttaaaaaacatggcttc
tgctgcatcgttgtttctgaaggagttaggaaccctgacggaacgtttttagcggaagct
ggcacccgtgatgcctttggtcatgcccaactaggtggtgtcgctccggtagttgctgac
atgattaaaactgcccatggttacaaataccattgggctgtggcagattatttacaacgt
gccgcacgccatatcgcctctaaaaccgatgtagaccaagcctatgcgatgggcaaagcc
gcggttgagcttgcgcttaacggaaaaaccgctgtcatgccaactattgttcgcaccagc
aataatccataccaatgggaaataggtgttggcgaattaaaagacgttgctaatgttgag
caaatgcttcctgcgcattacatcagtgaagatggttttggcattacccctgaatgtgaa
gaatacttgcgacctttaattatgggtgaagactctcctccttacgttaatggcctccct
caatacgttcgcttgaaaaacttaccggttgaaaaaatacttaacgagccgtttgacctg
taa

DBGET integrated database retrieval system