KEGG   Cycloclasticus sp. P1: Q91_2084Help
Entry
Q91_2084          CDS       T02265                                 

Definition
Uroporphyrinogen-III synthase / uroporphyrinogen-III C-methyltransferase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cyq  Cycloclasticus sp. P1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Q91_2084
Enzymes [BR:cyq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Q91_2084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2185117..2185860
Genome map
AA seq 247 aa AA seqDB search
MQSNEKTVLVTRPAHQSDHLCGLLTAAGFTPIRYPTIAIQAVENTAHISNTLYQHSNYDY
LIFISANAVIQADRLIDHQWQKTPSGMIAIGPKTADTLDQLGLKPAITAAKPFNSERLLT
QLPSDLKQKKGLIIKGKGGRTLLAEQLQKRGMTVDTLDVYQRTLPNNYKTSHNKKPAYIT
ITSQLALDNLFLIPPRPIGELKQQCTFVVFSERLARYASSLDCQHLLISHGASDKGLVSA
INQDKKR
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcagagtaatgaaaaaactgtcttagtcacgcggccggcccatcaatcagatcaccta
tgtggcctgttaacggcagcaggctttacaccaattcgctacccaaccatagcgattcaa
gctgttgaaaatacagcgcatattagcaacactttataccagcatagtaactacgattac
ctgatttttatcagtgcaaatgcagttatacaggccgatcgcctaatagatcatcaatgg
caaaaaacaccttctggcatgattgccattgggcctaaaacagccgacacgctggaccaa
ctcggtttaaaacctgccattactgccgctaaaccctttaattctgagcgcctacttaca
cagcttccaagcgaccttaagcaaaaaaaagggctcatcattaaaggcaaaggaggccgt
actttattggctgaacaattacaaaaacgcggcatgaccgttgatactcttgacgtatac
caacgcacattacctaataattacaagacaagccacaacaagaaacccgcctacatcact
atcactagtcaactggccttagacaacctatttctaatcccgccaaggcctattggtgag
cttaaacaacagtgtactttcgtggtctttagcgaacgacttgcccgctacgccagcagt
cttgactgccaacatctgctcattagtcatggggctagcgataaaggcttagtctctgcc
atcaaccaagacaaaaaacgctaa

DBGET integrated database retrieval system