KEGG   Cycloclasticus sp. P1: Q91_2116Help
Entry
Q91_2116          CDS       T02265                                 

Definition
aldehyde:ferredoxin oxidoreductase,tungsten-containing
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
cyq  Cycloclasticus sp. P1
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cyq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Q91_2116
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Q91_2116
Enzymes [BR:cyq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Q91_2116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2219440..2221299
Genome map
AA seq 619 aa AA seqDB search
MSWTKKVLRINLTNRTSSEEPLNMEWAELYLGQRGLATKYLTEEVDPTVEPLAPENKLYM
VTGPLTGTMASTGGRYSCVTKSPLTNALACSNSGGFFGNEMKCAGWDMIILEGKASSPVY
ISIVDEKCEILPADEIWGKSVWEADEWLHNKHQDPQLRIAAIGLPGEKGNLYSAIVNDLH
RAAGRSGVGAVMGSKNVKAVTLRGSKGVGNIKDPKRFFEATNKAKKIIADSEMTQGLSAL
GTNVMMNHMNEVGALPARNWQDSTFDNAPKLSSEAMAVPRESDGKPNLTRNAGCFACTIS
CGRISTIDPEHFSIKNRDDIHKHFKGNSGGNEYEAAWALGCDTGVDDLDAVTYANFVCNE
QALDPISAGATIAAAMELYELGILTKEDTGGIEMNFGNAEAMVECIELIAKHEGFGQELA
QSSLRFCEKYGRPDLAIVVKGQEFPAYDARAVKGMGLGYATSNRGACHVRGYTNGSETAG
IPFKTDPLAYEGKAELLMAFQDTTSVFDSAGICTFSSFAQGIEEVAEQIDAACEGDWTAE
RLGQLGERVWNLEREFNNNAGFTAADDTLPPRLLSEPVKAGPAKGEVCELDRMLPEYYEV
RGWNQDGTLKEATKQRLSL
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgagctggactaaaaaagtattacgcataaatctaacaaacaggacatcttctgaagaa
cctctcaatatggagtgggcagaactttatctaggccagagagggctagcgacaaagtac
cttacagaagaagtggacccaaccgtcgagcctctagcgccagaaaacaagctgtatatg
gtaacaggcccactaacaggcaccatggcttcaacgggtggtcgttactcttgtgtcact
aaaagccccttaaccaatgctctggcttgctcaaattcaggtggtttttttggcaacgaa
atgaaatgtgctggctgggatatgattatcctagaaggcaaagcaagctccccagtttat
atcagcatcgttgatgaaaaatgcgagatcctgccggcggatgaaatttggggcaaatct
gtttgggaagccgatgaatggcttcataataaacaccaagaccctcaactaagaatcgct
gctattggcctacctggtgaaaagggcaacctatattctgctatcgttaatgacttacat
cgtgctgctgggcgttccggcgtaggcgctgttatgggttcaaaaaatgtcaaagcggtg
acccttagaggcagcaaaggtgttggcaatataaaagatccaaaacgtttcttcgaagcc
actaacaaagctaaaaaaattatcgctgacagtgaaatgactcaaggcctcagcgcctta
ggtaccaatgtcatgatgaaccatatgaacgaagtgggtgctttaccggctagaaactgg
caagacagcacctttgacaatgcacctaaactgtcaagtgaggcaatggccgtaccaagg
gaaagtgacggtaagccaaacttaacacgaaatgccggctgctttgcctgcactatatct
tgtggacgtatctcaacaatcgacccagagcatttcagcattaaaaaccgtgatgacatc
cataagcactttaaaggtaattctggtggtaatgaatatgaagctgcatgggcattaggt
tgcgataccggtgtagatgatttagacgccgtgacctatgctaactttgtctgtaatgag
caagctcttgaccccatctcagcaggcgccactattgctgcagccatggagttatatgag
ctaggcatccttacaaaagaagatactggcggcattgaaatgaactttggcaatgctgag
gcgatggtggaatgtattgaactgattgcaaaacatgaaggctttggacaagaactcgct
caaagttcacttcgtttttgtgaaaaatacggccgcccagacctcgctattgttgttaaa
gggcaagagttcccagcctatgatgctcgcgctgtaaaaggcatgggtcttggatatgcc
acatcaaaccgtggcgcctgtcacgtacgtggttacactaacggctcagaaacagccggg
atacctttcaaaacagatccattagcctacgaaggaaaagcagaactactgatggcattc
caagatacaactagtgtgtttgattctgccggcatctgcaccttctcatcattcgcacaa
ggcattgaagaagtggcagaacaaattgatgctgcctgcgaaggcgactggacagctgaa
agactcggccaattaggcgagcgcgtttggaaccttgagcgtgagttcaacaacaatgct
ggtttcacagctgccgatgacacgcttccacctcgcttattaagtgagcctgtcaaagca
ggccctgcaaaaggtgaagtttgtgagctagatagaatgttgcccgaatactacgaagtt
cgtggttggaatcaagacggcacacttaaagaagcaacaaaacaacgcctaagtttgtaa

DBGET integrated database retrieval system