KEGG   Cycloclasticus sp. P1: Q91_2222Help
Entry
Q91_2222          CDS       T02265                                 

Definition
(GenBank) Tryptophan synthase b subunit
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cyq  Cycloclasticus sp. P1
Pathway
cyq00260  Glycine, serine and threonine metabolism
cyq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cyq01100  Metabolic pathways
cyq01110  Biosynthesis of secondary metabolites
cyq01130  Biosynthesis of antibiotics
cyq01230  Biosynthesis of amino acids
Module
cyq_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cyq00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Q91_2222
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Q91_2222
Enzymes [BR:cyq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Q91_2222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFT68255
UniProt: K0C713
Position
complement(2325081..2326259)
Genome map
AA seq 392 aa AA seqDB search
MPDEKGYFGEYGGQVIPPDLIAIMNDINRAYQDISKTPSFKDELNDLYTHYVGRPSPIFY
AKRLTEKLGGAKIFLKREDLNHTGAHKINHCLGEALLARHMGKTKVIAETGAGQHGVALA
TACALVGIDCEIHMGEVDIEKERPNVTKMKILGCTLVPVSRGTRTLKDAVDSAFEEYLKD
PVNFIYAIGSVVGPHPFPMMVRDFQSIIGKEARAQFLEEQGRLPDVITVCVGGGSNAIGL
FTAFLDDELVDIVGVEPAGRGLETGEHAATMSKGVKGALHGFECYNLQDQSGEPLPVYSI
ASGLDYPGVGPQHCLLKDLGRAKYVAIDDEECIDAFMTLSRVEGIIPALESAHAVAYAMK
IAKKMSSNETILVNLSGRGDKDAYFIADKLGL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgccggacgagaagggttactttggtgagtacggtggacaggttataccgcctgatctt
attgccatcatgaatgacattaacagagcttaccaagacatttcaaagacaccgtctttt
aaagatgagttaaatgatttgtacacccattatgtgggacgtccaagtcctattttttat
gcgaaacgattaacggaaaagttaggtggtgctaaaatttttctaaaaagagaggatcta
aaccatacgggtgcgcataagataaatcattgccttggcgaggcattattagcacgacac
atgggtaaaactaaggtgatcgctgaaacaggagcgggtcagcatggggtggcgttagca
acggcttgtgccttagtgggtatcgattgcgaaattcacatgggtgaggtggatattgaa
aaagaacgccctaatgtgacgaagatgaaaatattgggttgtactttagtaccggtcagt
cgtgggacgagaacattgaaggacgctgtagatagtgcgtttgaagaatacttaaaagac
ccagttaattttatttatgcgattggctcggttgttgggccgcaccctttccccatgatg
gtaagagacttccaaagcattataggtaaagaagcgcgcgcgcagtttcttgaggagcag
gggcgtttgcctgatgttattactgtatgtgttggtggtggttcaaatgcaataggacta
tttacagcttttttggacgacgaattggttgatattgttggggtggagccagcagggaga
ggcttagaaacaggtgagcatgcggcaaccatgagtaaaggggttaaaggagctttgcat
ggatttgagtgctacaacttacaagatcaatcaggtgagccgctacctgtctattcgatt
gcatcagggttggattatccaggggttggacctcagcactgtttgttaaaagatttgggt
cgagcgaaatatgttgctatagatgatgaagagtgtattgatgcctttatgaccttatca
agggtagagggcattatcccagcactagaaagcgcacatgctgtggcgtacgcgatgaaa
atagcaaaaaaaatgagctcaaatgagacgattttagtcaatctatctggtcgtggtgat
aaggatgcttactttatagcagataagttagggttgtag

DBGET integrated database retrieval system