KEGG   Cyanothece sp. ATCC 51142: cce_0006Help
Entry
cce_0006          CDS       T00686                                 

Definition
hypothetical protein
Orthology
K11331  
cation efflux system protein involved in nickel and cobalt tolerance [EC:3.2.1.17]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    cce_0006
Enzymes [BR:cyt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     cce_0006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(6523..7227)
Genome map
AA seq 234 aa AA seqDB search
MIIQHSQPKRKGTKYRLKKPYKLVFNLIIVVGLIGLVYSFKKNTQPLVNPSLVTHLPELE
MSGGDPYIRALMLTISASESNHKNSYYLLYGGSHVHNLQQHPDQCIPINIGPNRGNCSTA
AGRYQFLNSTWQEKARKYHPNPQKNYRQYIYSFEPKYQDIVVYRWLKDHHQWNVDLLTLL
KQDQVEEVLRKLSNVWTSLGGGIEDNSMTPHLPSIYRYFLAQELNRENADQNSL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgattattcaacattcccaacccaaacgcaaaggcacaaaatatagactgaaaaaacct
tataaattagtatttaatttaatcatcgttgttggattaattggattagtttatagtttc
aaaaaaaatactcaacctttagttaatccatcattagttactcatttacctgaactcgaa
atgtctggcggtgatccttatattcgggctttaatgttaacgatttctgccagtgaatcc
aatcataaaaattcctattatctcttatatggtggtagtcatgttcataatcttcaacaa
catccggatcagtgcataccaattaatattggacccaatagagggaactgttcaaccgca
gccggacgctatcaatttttgaattctacttggcaagaaaaagctagaaaatatcatcca
aaccctcagaaaaattatagacaatatatctatagttttgaaccaaaatatcaggacatt
gtggtttatcgttggctcaaagatcatcatcaatggaacgtagatttattaactttactc
aaacaagatcaagtcgaagaagtattaagaaaattatctaatgtttggacaagtttaggg
ggtggaattgaagataattctatgactcctcatttacctagtatttatcgttattttttg
gcacaagaattgaacagagaaaacgcagatcaaaatagtttgtaa

DBGET integrated database retrieval system