KEGG   Cyanothece sp. ATCC 51142: cce_0199Help
Entry
cce_0199          CDS       T00686                                 

Gene name
chlI
Definition
magnesium chelatase, ATPase subunit I
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cyt00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
184508..185584
Genome map
AA seq 358 aa AA seqDB search
MTATLQAPPKTHRVVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRAL
ADLLPEIEVVDNDPFNSHPSDPDLMSDNVRQALEEQGSLPVAHKKVIMVDLPLGATEDRV
CGTIDIEKALSEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTVERE
GISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPNLRVQIVEQRSEFDRDP
QKFCETYQSQQEELQNSLVKAQNLLPSVNIDYDLRVKISEVCSELDVDGLRGDIVTNRAS
KALAAFEGRTEVTVDDIRRTMVLCLRHRLRKDPLETIDSGYKVEKAFNRVFGLETEEN
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaccttacaagcacctccaaaaacccatcgcgttgtatttccctttacagct
attgtgggccaagaagaaatgaaattggccttactcctcaatgtcattgacccgaaaatt
ggcggtgtgatgattatgggcgatcgtgggacaggaaaatcgacgacgatccgagcttta
gccgacttactgcctgaaattgaagtggtagacaacgatccctttaactctcatccctct
gatccggatttgatgagtgacaatgtccgtcaagccttagaggaacaaggatcgttaccc
gttgctcacaaaaaagtgatcatggttgacttaccccttggtgcaaccgaggatagggtg
tgtggcaccattgatattgaaaaagctttatccgaaggggttaaagcatttgaaccaggt
ctattagctaaggcaaaccgagggatcttatatgtagatgaagttaacctccttgacgat
cacttagtagacgtattattagactctgcggccagtggttggaatacggtagaaagggaa
gggatttccattcgtcacccggctagatttgtgttagtggggtcaggaaaccccgaagaa
ggagagttgcggccgcaattattggatcgttttggaatgcacgcagagatccatacggtt
aaagaacccaacttacgagtacaaattgtagaacaacgatcagaatttgatcgtgatcct
caaaaattctgtgaaacttatcaatctcagcaagaagagttacaaaacagtttagtaaaa
gcgcaaaatctattgccttcggttaacatcgattatgatttacgggtaaaaatctccgaa
gtttgttcagaattggatgtggatggactacggggggatattgtaaccaaccgtgcatca
aaggcgttagcagcgtttgaaggccgtacagaggtgacggtagatgatattcgacggaca
atggtgttatgtttgcgtcaccgactcagaaaagatcccttagaaaccattgactcaggt
tacaaagtagaaaaagcttttaatcgtgtttttggactagaaactgaggaaaattag

DBGET integrated database retrieval system