KEGG   Cyanothece sp. ATCC 51142: cce_0594Help
Entry
cce_0594          CDS       T00686                                 

Gene name
proB
Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    cce_0594 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    cce_0594 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    cce_0594 (proB)
Enzymes [BR:cyt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     cce_0594 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(592286..593413)
Genome map
AA seq 375 aa AA seqDB search
MNHSQTIVIKIGTSSLAQPETGKLALSTIAALVETLTELRQLGYDVVLVSSGAVGVGCSR
LKLTERPKKIATKQAIAAVGQGRLIRVYDDLFTALNQPIAQILLTRRELMERSCYVNAKN
TFDALFELGVIPIVNENDTVAIEELKFGDNDTLSALVASLINANWLFILTDVDRLYSADP
RTFPDAKPIKVVNSLQLDQLQVKAGNKGSQWGTGGMSTKLTAARLATSVGVTTVITHGKK
PENLLKIINGEDIGTKFEAQLKNDNARKRWIAYGLLPRGKLYLDKGAVKAISQKGKSLLA
AGILKVEGSFDSADAVQLCDETGQEIARGIVNYNQEEINKIKGNHSNQIPELLGYDGGGT
IVHRDNLVINGTFKN
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaaccactcccagactatcgttattaaaattggtacctctagtcttgctcaaccagag
acaggaaaattagctttatcaactattgctgctcttgtggaaactttaacagaattacga
caattaggctacgatgttgttttagtttcatctggtgcagtgggagtgggttgtagtcgt
ttaaagttaacagaaagacccaaaaaaatagccaccaaacaagcgattgccgccgtagga
caaggccgattaattcgggtttatgatgacctttttaccgctttaaatcaacccattgct
caaattttgttaactcgtagagaattaatggaacggagttgttatgtcaatgctaaaaat
acctttgatgcgctgtttgaattaggggttattcctattgttaatgaaaacgatacggtg
gctattgaagagttaaaatttggagataatgataccctttctgctttagtcgctagttta
attaatgccaattggttgtttattttaacggatgttgatcgactttattcagctgatcct
cgcacttttcctgatgctaaacctatcaaagttgttaacagtttacaattagaccaatta
caagttaaagcagggaataaaggatctcaatggggaacaggaggaatgtcaaccaaactc
acagcagcaagactggctacatctgtaggggtgaccacggttatcacccacggaaaaaaa
ccagaaaacttattaaaaataattaatggagaagatattggcaccaaatttgaggcacaa
ttaaagaatgataatgctcgaaaacgttggatcgcctatggtttattacctagaggaaaa
ttgtatctcgataagggtgcagttaaagcgatttctcaaaaaggaaagtctttgttagca
gcaggaattcttaaagtcgaaggcagttttgattcagcagatgcagttcaattgtgtgat
gaaactggtcaagaaattgctagaggtattgttaattataatcaagaagagattaataaa
ataaaaggaaatcactccaatcaaattccagaattattagggtatgatggaggagggact
attgtacatcgagataatttagttattaatggaacttttaaaaattaa

DBGET integrated database retrieval system