KEGG   Cyanothece sp. ATCC 51142: cce_0595Help
Entry
cce_0595          CDS       T00686                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cce_0595 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cce_0595 (glk)
   00052 Galactose metabolism
    cce_0595 (glk)
   00500 Starch and sucrose metabolism
    cce_0595 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    cce_0595 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    cce_0595 (glk)
   00524 Butirosin and neomycin biosynthesis
    cce_0595 (glk)
Enzymes [BR:cyt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     cce_0595 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(593444..594487)
Genome map
AA seq 347 aa AA seqDB search
MTVLLAGDIGGTKTILRLVNSEQPKNGENLPQQTTLYEKSYPSQNYDDLVPIVQEFLKEA
KQELEQEITIKNGCFGIAGPVVNNTSELTNLSWSLTGDRLEKQLSLERVNLINDFAAIGY
GILGLEKDDLYILQDMEPKPNTPMAVLGAGTGLGECFLTPLESGIYEVFSSEGSHGDFAP
RNELEFELLTYIQDNYNLPRVSIERIVSGMGISAIYQFLRHKYPEKESEKFKEIYQAWES
KQKVDLSAEVSKAAMENNDALCQQTMELFISAYGAEAGNLALKILPYGGLYVAGGIAAKI
LPLLKKGSFIEAFKAKGRMSSLLAQMPVYVILNPKVGLIGAALRAAR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgactgtattactcgctggcgatattggaggaactaaaacaattttacgtttagttaat
tcggaacagcctaaaaatggagaaaatttacctcaacaaactaccttgtatgaaaaatct
tatcccagtcaaaactatgatgatttagttcctattgttcaagaatttttaaaagaagct
aaacaagaattagaacaagaaattaccatcaaaaatggctgttttggtattgctggacca
gtggttaataatacctcagaattaaccaatttaagttggtcattaactggcgatcgctta
gaaaaacagttatctttagaaagagtgaatctgattaatgattttgctgctattggttac
ggtattttggggttagaaaaagatgatttatacatcttacaagatatggaacccaaacct
aatacgccgatggcagttttaggtgccggaacggggttaggagaatgttttttgacccct
ttagaaagtggtatttatgaggtattttcttcagaaggatctcatggagactttgcgcca
cgaaatgaactagaatttgaattattaacttatattcaagataactataatttacctaga
gtgtccatagaaaggattgtttctggtatgggaattagtgcgatatatcaattcttacgt
cataaatatcctgaaaaagaatcagaaaaattcaaagaaatttatcaagcttgggaaagt
aaacaaaaggtggatttaagtgcagaagtgtctaaagcagcgatggaaaataatgatgct
ttatgtcaacaaacaatggaactatttatttcagcttacggcgcagaagctggaaattta
gctttaaaaatattaccctacggaggtttatatgtagcaggaggaattgctgctaaaata
ttacctttattgaaaaaaggatctttcatagaagcttttaaggctaaaggacgtatgagt
tcactgttagctcaaatgcctgtttatgttattttaaatcctaaagttggtttaattggg
gctgcgttaagggctgctagataa

DBGET integrated database retrieval system