KEGG   Cyanothece sp. ATCC 51142: cce_0669Help
Entry
cce_0669          CDS       T00686                                 

Gene name
pfkA1
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cce_0669 (pfkA1)
   00030 Pentose phosphate pathway
    cce_0669 (pfkA1)
   00051 Fructose and mannose metabolism
    cce_0669 (pfkA1)
   00052 Galactose metabolism
    cce_0669 (pfkA1)
  Energy metabolism
   00680 Methane metabolism
    cce_0669 (pfkA1)
Enzymes [BR:cyt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     cce_0669 (pfkA1)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     cce_0669 (pfkA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
679540..680622
Genome map
AA seq 360 aa AA seqDB search
MGEKKRIGILTSGGDCAGLNAVIRAVVHHAVGTYNWDVIGIREATQGLMSDPPRFIQFEL
DKLDNLLLMGGTILGTTNKGDPFAFPMNDGTVRDRSSDIINGYHSLGLDALIGIGGDGSL
AILRRLAQQGGINLVGIPKTIDNDVGATEVSIGFDTATNIATEALDRLHFTAASHNRVMI
LEVMGRDAGHIALAAGIAGGADVILIPEIPYKIEKVCQKIRARQEKGKHFCLVMVSEAVR
TEVGEQVSKLKQFGEDRLGGIGKYIAEQIGAKTGAETRVTVLGHIQRGGIPSPMDRLLGS
AFGVAAVDLIAQGKFDQMVAWQNRQILSVPIAEAIQTYRTVDPEETLVKTARGLGICLGD
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgggtgagaaaaaacgcatcggaattcttaccagtggtggggactgtgctggattaaat
gctgttattcgtgcagtggtgcatcatgcagtaggaacctataattgggacgttattggg
atcagagaagcgacgcaagggttaatgagtgatccgcctcggtttatccaatttgagcta
gataaattggataacctattgttaatgggagggactattttagggactactaataaagga
gatcccttcgcatttcctatgaatgacgggacagtacgcgatcgctcatcagacattatt
aacggttatcatagtttaggattagatgctttaattggcattggaggggatggaagttta
gccatattacgtcgtttggcccaacaaggaggcattaacctagtgggtattcccaaaacc
attgataacgatgtgggtgccaccgaagtgtctattggtttcgataccgctaccaacatc
gccacagaagccttagatcgccttcattttactgcagccagtcataaccgcgtcatgatt
ttagaggtcatgggaagagacgcaggacatattgctttagccgcaggtattgctggagga
gcagatgtcatcttaattcccgaaattccctataaaatagagaaagtttgtcaaaaaatc
cgcgccagacaagaaaaagggaaacatttttgtttagtcatggtatccgaagcggtacgc
acagaagttggagaacaagttagcaaattaaagcaatttggagaagatcgcttagggggc
attggcaagtatatcgctgagcaaataggggctaaaacaggggcagaaacccgtgtaact
gtccttggccatattcaacgaggagggataccttctccgatggatcgcctgttggggtca
gcgtttggggtggctgcggttgatttaattgctcagggaaaatttgatcagatggttgca
tggcaaaaccgacaaattcttagtgtccctattgctgaagcgattcaaacctatcgtact
gttgacccagaagaaacattagtcaaaacagcgagagggttaggtatttgtttaggagat
taa

DBGET integrated database retrieval system