KEGG   Cyanothece sp. ATCC 51142: cce_0669Help
Entry
cce_0669          CDS       T00686                                 

Gene name
pfkA1
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cce_0669 (pfkA1)
   01230 Biosynthesis of amino acids
    cce_0669 (pfkA1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cce_0669 (pfkA1)
   00030 Pentose phosphate pathway
    cce_0669 (pfkA1)
   00051 Fructose and mannose metabolism
    cce_0669 (pfkA1)
   00052 Galactose metabolism
    cce_0669 (pfkA1)
  Energy metabolism
   00680 Methane metabolism
    cce_0669 (pfkA1)
Enzymes [BR:cyt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     cce_0669 (pfkA1)
Protein phosphatases and associated proteins [BR:cyt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     cce_0669 (pfkA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
679540..680622
Genome map
AA seq 360 aa AA seqDB search
MGEKKRIGILTSGGDCAGLNAVIRAVVHHAVGTYNWDVIGIREATQGLMSDPPRFIQFEL
DKLDNLLLMGGTILGTTNKGDPFAFPMNDGTVRDRSSDIINGYHSLGLDALIGIGGDGSL
AILRRLAQQGGINLVGIPKTIDNDVGATEVSIGFDTATNIATEALDRLHFTAASHNRVMI
LEVMGRDAGHIALAAGIAGGADVILIPEIPYKIEKVCQKIRARQEKGKHFCLVMVSEAVR
TEVGEQVSKLKQFGEDRLGGIGKYIAEQIGAKTGAETRVTVLGHIQRGGIPSPMDRLLGS
AFGVAAVDLIAQGKFDQMVAWQNRQILSVPIAEAIQTYRTVDPEETLVKTARGLGICLGD
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgggtgagaaaaaacgcatcggaattcttaccagtggtggggactgtgctggattaaat
gctgttattcgtgcagtggtgcatcatgcagtaggaacctataattgggacgttattggg
atcagagaagcgacgcaagggttaatgagtgatccgcctcggtttatccaatttgagcta
gataaattggataacctattgttaatgggagggactattttagggactactaataaagga
gatcccttcgcatttcctatgaatgacgggacagtacgcgatcgctcatcagacattatt
aacggttatcatagtttaggattagatgctttaattggcattggaggggatggaagttta
gccatattacgtcgtttggcccaacaaggaggcattaacctagtgggtattcccaaaacc
attgataacgatgtgggtgccaccgaagtgtctattggtttcgataccgctaccaacatc
gccacagaagccttagatcgccttcattttactgcagccagtcataaccgcgtcatgatt
ttagaggtcatgggaagagacgcaggacatattgctttagccgcaggtattgctggagga
gcagatgtcatcttaattcccgaaattccctataaaatagagaaagtttgtcaaaaaatc
cgcgccagacaagaaaaagggaaacatttttgtttagtcatggtatccgaagcggtacgc
acagaagttggagaacaagttagcaaattaaagcaatttggagaagatcgcttagggggc
attggcaagtatatcgctgagcaaataggggctaaaacaggggcagaaacccgtgtaact
gtccttggccatattcaacgaggagggataccttctccgatggatcgcctgttggggtca
gcgtttggggtggctgcggttgatttaattgctcagggaaaatttgatcagatggttgca
tggcaaaaccgacaaattcttagtgtccctattgctgaagcgattcaaacctatcgtact
gttgacccagaagaaacattagtcaaaacagcgagagggttaggtatttgtttaggagat
taa

DBGET integrated database retrieval system