KEGG   Cyanothece sp. ATCC 51142: cce_0973Help
Entry
cce_0973          CDS       T00686                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyt00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    cce_0973 (glpK)
Enzymes [BR:cyt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     cce_0973 (glpK)
Exosome [BR:cyt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   cce_0973 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(974230..975747)
Genome map
AA seq 505 aa AA seqDB search
MLSPMTNNKTKYILALDLGTTGNRAIIFNHEGAMVGQAYKELTQYYPQPGWLEHDALEIW
QDTLSVLGQVLEKTRIAGKDIVAIGLTVQRETCLLWDKTTGKPLHKAIVWQDRRTSPMCS
QLREMGKVEEIEGRTGLVLDPYFSATKLAWLMDWVKENKPDTNFDNVIAGTVDTWMLWNL
TGRKVHATDHSNASRTMLMNLDTRNWDESLLDLFNIPAHIMPEIKPSMGMFGHTDADLLG
VEIPITAIFGDQQAALFAHGCSRPGLLKCTYGTGAFLIVQAGHEVMRSPNGLLSTVAWTQ
DKSTNYALEGAIFTAGASIQWLRDGIKLINSAAETEAICHQVADTNGVYFVPALSGLGAP
HWDMSARGLYIGITGGVQREHMVRAVLEAIAYQVKEVVDAMNKDSDLSVARLKVDGGASQ
NNFLMQFQADALGVPIERPVVLDATAQGAAFGAGLTVGYWDNYDDLIARRQIDRVFEPGK
NSSAVQENFLTWTRAVERAKHWIEE
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
gtgttatcaccaatgacgaataataaaacaaaatatatcttagctcttgatttaggaacc
actggcaaccgtgctattatctttaatcatgaaggggcaatggttggccaagcttacaaa
gaactcacccaatattatccccaacccggttggcttgaacacgatgccctagaaatttgg
caagacaccttaagtgtcctaggacaagtgctagaaaagacccgtattgctggtaaagat
atcgtagccatcggtttaacggtgcaacgggaaacctgtttattgtgggataaaaccaca
gggaaaccccttcataaagcgatcgtttggcaagatagacgcacctcccccatgtgtagt
caattacgagaaatgggtaaggtagaagagatcgaaggccgtacaggtttagtgttagac
ccctatttctctgcgacaaaattggcctggttaatggactgggtaaaagaaaataaaccc
gataccaattttgataacgtcatcgctggaacggtggatacttggatgttgtggaaccta
accggccgaaaagttcacgcaacagaccatagtaacgcttctcgtaccatgttgatgaat
cttgatactcgtaactgggacgaaagcctactggatttattcaacattcctgcccatatt
atgcccgaaattaaaccaagtatggggatgtttggtcatactgatgctgacttattgggg
gttgaaattcccattaccgctattttcggggatcaacaagctgctttatttgctcatggt
tgcagtcgtccagggttactcaaatgcacctacggaaccggtgcgtttctcattgtccaa
gccggtcatgaagtcatgcgttctccgaatgggttattatctaccgttgcatggactcag
gataaatccaccaattacgctctagaaggggcaattttcaccgcaggggcttccattcaa
tggttacgggatgggattaaattgatcaacagcgcagcggaaactgaggctatttgtcat
caagtggctgatactaatggcgtttattttgtccctgctttaagtgggttgggtgcgcct
cactgggatatgtcagcacgaggattgtatataggtattactggcggtgtgcagcgagaa
cacatggttagggcggtgttagaagcgatcgcttatcaggtaaaagaagtggtggatgcg
atgaataaagattcagatttatcggtagcgcggttaaaagtggatggcggtgcgtctcaa
aataactttttaatgcagtttcaagccgatgctttaggggttcctatcgaacgcccagtg
gttttagatgccacggcacagggggctgcctttggagccgggttaacggtgggttattgg
gataattatgatgatttgatcgcccgtcgtcaaatcgatcgcgtctttgaaccgggaaaa
aattcgagtgcagtacaagagaactttttgacttggacaagagccgttgaacgggcgaaa
cattggattgaagagtaa

DBGET integrated database retrieval system