KEGG   Cyanothece sp. ATCC 51142: cce_1317Help
Entry
cce_1317          CDS       T00686                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cyt  Cyanothece sp. ATCC 51142
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:cyt00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
1315947..1316957
Genome map
AA seq 336 aa AA seqDB search
MTERSFGAISEPLKLLIVNLEIIMRTYRLIAPAKINLYLEIIGDRPDGYHELVMILQSIE
LGDQIEIRSNGTQTINLHCNHPLVPRNQTNISYRAAQLMVDQFPERFANYGGVDITIDKQ
IPVAAGLAGGSTDGAAVLLGLNLLWELGLTIPQLQSLGEKLGSDVPFCVRGGTAIATGRG
EKLDPIQDLDSLWVVLAKYNNLSVSTPWAYKTYKQQFGHTYINDLTGIQSRSSQLHSGSF
VQAISDKDGKKIGQLLQNDLEKVVLPEYPQVAQLKEILQQAGGLGTMMSGSGPTIFTLCQ
SQSEAETIKKTARQAIQDPNLEFWVTQLSSNGIQVI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgactgaaagaagttttggggctatctcagaaccgttaaaattattaattgttaattta
gaaatcatcatgcgaacctatcgattaattgcccctgctaaaattaatttatatctagaa
attattggcgatcgccccgatggttatcatgaattagtaatgattttacagagtattgaa
ttgggggatcagatcgaaattcgctccaacggaacccaaacgattaatctacattgtaat
catcctttagttcctcgtaatcagacaaatatttcttatcgcgctgctcaattaatggtg
gatcaatttcccgaacggtttgctaattatgggggagttgatattactattgataagcaa
attcctgtggccgcaggattagccggaggctcaacagatggggctgcggtgttattaggt
ttaaatttattatgggaattaggcttaaccataccccagttacaaagcttaggagaaaaa
ttaggatcggatgtgccattttgtgtcaggggaggaacagcgatcgctacagggagaggg
gaaaaattagatccaattcaagatttagatagcttatgggttgtcctcgctaaatataat
aatctttcggtttctacgccctgggcttacaaaacctataagcaacaatttggccatacc
tacattaatgatcttacaggaattcagtctcgaagttctcaacttcattctggatctttt
gtgcaagctattagtgataaagatggaaaaaaaataggacaattattacaaaatgattta
gaaaaagttgtcttacctgaatatcctcaagttgcccaattaaaagagattttacaacaa
gcaggagggttgggaaccatgatgtcaggatcaggtccaactatatttaccttgtgtcag
tctcaaagcgaagcagaaaccatcaaaaaaacagccagacaagctattcaagaccctaat
ttagaattttgggtaactcaattatctagtaatggcattcaagttatttaa

DBGET integrated database retrieval system